CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10010|VNG2658G    --------MTNGKYAARKLKKDRQQRRWSDSEYARRERGLGKKSDPLEGAPQGRGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFI
MET10014|MJ1046      ---MSGSKSPRGEFAGRKLRLKRKWCRWHDYNYVRRVLKLKEKYDPLEGAPMARGIVIEKVGLEAKQPNSAIRKCVRVQLIKNGRVVTAFCPGNHAINFI
PYR10010|PH1542      VMLMPGKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAINFI
THE10012|TTHA1697    -----VVALPTINQLVRKGREKVR--KKSKVPALKG-------------APFRRGVCTVVRTVTPKKPNSALRKVAKVRLT-SGYEVTAYIPGEG--HNL
SYN10013|sll1096     --------MPTIQQLIRSERSKVQ--KKTKSPALKQ-------------CPQRRGVCTRVYTTTPKKPNSALRKVARVRLT-SGFEVTAYIPGIG--HNL
BAC10012|Bsu0110     --------MPTINQLIRKGRVSKV--ENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLT-NGIEVTAYIPGIG--HNL
ECO10012|rpsL        --------MATVNQLVRKPRARKV--AKSNVPALEA-------------CPQKRGVCTRVYTTTPKKPNSALRKVCRVRLT-NGFEVTSYIGGEG--HNL
SUL10010|ST0272      ---MAGGKSPKGMFAARKLRLKRLKFRWHQRKFKRRMLKLKEKFDPLEGAPMARGVVLEKVGIESRQPNSAVRKAVRVQLVKNGRIVTAFVPGDGGVNFI


HAL10010|VNG2658G    DEHDEVTIAGIGGAKGR-AMGDLSGVNYKVEKVNGVSLIELVRGNAEKPVR-------
MET10014|MJ1046      DEHDEVIIEGIGGPKGPRAKGDIPGVKYKVIMVGRNSLRELVRGRQEKIKR-------
PYR10010|PH1542      DEHDEVIIEGIGGPKGG-SMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR-------
THE10012|TTHA1697    QEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK
SYN10013|sll1096     QEHSVVLIRGGRVKDLPGVRYHIVRGTLDATGVKDRKQGRSKYGTKREKAKK------
BAC10012|Bsu0110     QEHSVVLIRGGRVKNLPRVRYHIVRGALDTAGVENRAQGRPKYGTKKPKAK-------
ECO10012|rpsL        QEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA--------
SUL10010|ST0272      DEHDEVVIAGIGGTLGR-SMGDLPGVRYKVIMVNGVSLDALYKGKKQKPVR-------