CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10015|RPS13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
DOG10014|Rps13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
MUS10014|Rps13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
RAT10014|Rps13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
CHK10014|Rps13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
FUG10014|RPS13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIFKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
DAN10014|Rps13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIFKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
MED10014|Rps13       MGRMHAPGKGLSQSALPYRRSVPTWLKLTS--DDVKEQIFKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAV
CIO10014|RPS13       MGRMHAPGKGLSSSALPYRRSVPTWLKLSS--EDVKEQIYKLAKKGLRPSQIGVILRDSHGVAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAM
DRO10017|RpS13       MGRMHAPGKGISQSALPYRRTVPSWLKLNA--DDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAI
MOS10014|Rps13       MGRMHAPGKGISKSALPYRRSVPSWLKLSA--EDVKEQIKKLGKKGMTPSQIGIILRDSHGVAQVRFVNGNKVLRIMKAVGLKPDIPEDLYFLIKKAVSI
BEE10014|Rps13       MGRMHAPGKGISQSALPYRRSVPTWLKLTP--EDCKELIYKLAKKGHTPSQIGVILRDSHGVAQVRFRTGNKILRIVKSMGLAPDLPEDLYYLIKKAVAI
CEL10014|rps-13      MGRMHNPGKGMAKSAIPYRRSVPSWQKMTA--EEVQDQIVKMAKKGLRPSQIGVILRDSHGVGQVRRLAGNKIFRILKSKGMAPELPEDLYHLVKKAVAI
BMA10014|RPS13       MGRMHNPGKGISQSALPYRRSVPTWLKLTS--EEVQEQITRLAKKGLRPSQIGVILRDSHGVAQVRRVTGNKIVRILKSKGMAPEIPEDLYHLIKKAVNI
STE10014|RPS13       MGRMHAPGKGISGSALPYRRSVPTWQKLTS--DDVKEQMYKLAKKGLTPSQIGVILRDSYGVAQVRYITGNKILRILKAKGLAPSLPEDLYCLIKKAVAV
MBR10014|RPS13       MGRMHTPGKGISRSAAPYVRTAPAWLKNLYGSDDVKELIYNLARKGMTPSKIGVVLRDSRGIASVKSLTGTKILRILKGRGLAPELPEDLYCLIKKAVSM
NEU10014|Rps13       MGRMHSKGKGISASAIPYSRNPPSWLKTTP--EQVVDQICKLAKKGATPSQIGVILRDSHGIAQVKVVTGNKILRILKSNGLAPDLPEDLYMLIKKAVAV
GRI10014|Rps13       MGRMHSNGKGISASAIPYSRNPPAWLKTTP--DQVVEQICKLARKGATPSQIGVVLRDSHGIAQVKIVTGNKILRILKSNGLAPDIPEDLYMLIKKAVSV
GRA10014|Rps13       MGRLHSKGKGISASALPYSRSSPAWLKTTP--EQVVEQISKLARKGATPSQIGVILRDSHGIAQVKHVTGNRILRILKSSGLAPELPEDLYMLIKKAVAV
STA10014|Rps13       MGRLHSNGKGISASAIPYSRSPPAWLKTTP--EQVVEQIQKLAKKGATPSQIGEILRDSHGIAQTKVVTGNKILRILKSNGLAPEIPEDLYMLIKKAVAV
YAR10014|Rps13       MGRMHSKGKGMSASAIPYSRNAPSWFKLTP--DAVVEQIIKYARKGLTPSQIGVLLRDSHGVSQVKVATGNKILRILKSNGLAPEIPEDLYHLIKKAVSV
POM10025|RPS13       MGRMHSKGKGIASSALPYVRSPPAWCKADA--DSVVEQILKFSKKGMSPSQIGVTLRDSHGIPQVRFITGQKIMRILKANGLAPELPEDLYNLIKKAVSV
YST10023|RPS13       MGRMHSAGKGISSSAIPYSRNAPAWFKLSS--ESVIEQIVKYARKGLTPSQIGVLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSV
CIN10014|Rps13       MGRLHAPGKGISSSALPYRRTPPSWLKATP--EEVIEQIVKLARKGLTPSQIGVTLRDSHGIPQVRFVTGNKILRILKSQGLGPSIPEDLWHLIKKAVAV
NEA10014|Rps13       MGRMHSKGKGMSASALPYRRSQPSWSKATP--EEVCDQIFKLARRGLSPSQIGVILRDSQGIPQVKSVTGNKILRILKTNGLAPSIPEDLYHLIKKAVSV
MAY10014|Rps13       MGRMHSKGKGISASALPYRRTPPSWLKTTP--EEVVEQITKLARKGMTPSQIGVQLRDSQGIAQVRFVTGNKILRILKSQGLAPQIPEDLYHLIKKAVSV
RHI10054|Rps13       MGRMHTPGKGISSSALPYRRTPPSWVKTTS--EEVVDMICKNAKKGLTPSQIGVILRDSYGIPQVRSITGNKVLRILKSSGLAPEVPEDLYHLIKKAVSI
RHI10055|Rps13-2     MGRMHTPGKGISSSALPYRRTPPSWVKTTS--EEVVDMICKNAKKGLTPSQIGVILRDSYGIPQVRSITGNKVLRILKSSGLAPEVPEDLYHLIKKAVSI
RHI10056|Rps13-3     MGRMHTPGKGISSSALPYRRTPPSWVKTTS--EEVVDMICKNAKKGLTPSQIGVILRDSYGIPQVRSITGNKVLRILKSSGLAPEVPEDLYHLIKRAVSI
ARA10034|RPS13A      MGRMHSRGKGISASALPYKRSSPSWLKTTP--QDVDESICKFAKKGLTPSQIGVILRDSHGIPQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAI
ARA10035|At4g00100   MGRMHSRGKGISASALPYKRSSPSWLKTTS--QDVDESICKFAKKGLTPSQIGVILRDSHGIPQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAI
RIC10045|RPS13A      MGRMHSRGKGISSSALPYKRTPPSWLKTAA--SDVEEMIMKAAKKGQMPSQIGVVLRDQHGIPLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAI
RIC10046|RPS13A      MGRMHSRGKGISSSAIPYKRTPPSWVKTAA--ADVEEMIMKAAKKGQMPSQIGVVLRDQHGIPLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAI
RIC10047|RPS13B      MGRMHSSGKGMSCSVLPYRRAAPAWVKTSA--SEVEEMIVRVAKKGQLPSQIGAILRDAHAVPLAQGVTGGKILRVLKSRGLAPEVPEDLYFLIKKAVAM
GMA10067|RPS13       MGRMHSRGKGISSSALPYKRTPPSWLKISS--QDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSI
GMA10068|RPS13       MGRMHSRGKGISSSALPYKRTPPSWLKISS--QDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSI
GMA10069|RPS13       MGRMHSRGKGISSSALPYKRTPPSWLKISS--QDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSI
POP10014|RPS13       MGRMHSKGKGISASALPYKRTSPSWLKISP--QDVDDNICKFAKKGLTPSQIGVILRDSHGIAQVKTVTGNQILRILKAHGLAPEIPEDLYHLIKKAVAI
CRE10014|RPS13       MGRMHSKGKGKASSAIPYKRSPPSWCKTTG--AEVQEMICKFARKGMTPSQIGIVLRDQHGVPLINTVTGSKVLRILKGAGLAPEIPEDLYFMIKKAVSI
VOL10015|RPS13       MGRMHSSGKGKSSSAIPYKRSPPSWCKTTS--AEVQDMICKFARKGMTPSQIGIILRDQHGVPLVSTVTGSKVLRILKGSGLAPEIPEDLYFLIKKAVSI
HEM10012|rps13       MARMHNKRKGISSSLIPFKRKSPDWSNENL--QEINSLILKLAKKGLVPSQIGVYLRDCKGIPQVKTITGTKILRILKINGVAPELPEDLFFLIKKSINV
PTR10014|RPS13       MGRMHAPGKGISRRALPFKRTPPSWLKVSS--ADVEDQVCKLAKKGLTPSQIGVILRDSNGIAQVKFVTGQKVVRILKANGLAPEIPEDLYMLIKKAVQV
TPS10014|Rps13       MGRMHAPGKGISKSAKPYKRTPPSWCKVSA--TDVEEHVCKLAKKGLTPSQIGVILRDSHGIAQVHTVTGQKIVRILKANGLAPEIPEDLYMLIKKAVAV
CYA10014|RPS13-2     MGRLHSKGKGISSSAIPYRRAAP-WCKTSR--KECVDLIVRLARKGMTPSQIGVQLRDQHGVPLSKPITGNTIVRVLRAHGLAPEIPEDMYFLVKKAVNI
CYA10015|RPS13       MGRLHSKGKGISSSAIPYRRAAPSWCKTSR--KECVDLIVRLARKGMTPSQIGVQLRDQHGVPLSKPITGNTIVRVLRAHGLAPEIPEDMYFLVKKAVNI
DIC10014|RPS13       MGRMHSNGKGISGSSLPYNRKPHAWTKPTA--SEVCETVCKLAKRGYTPSKIGSSLRDSLGVAQVKNVTGSKILRILKVNGLAPTIPEDLYHLIKKAVTI
PLA10015|RPS13       MGRMYGKGKGISSSTLPYKRKQPSWLKQKP--SEIEDAIIKLAKKGQTPSQIGATLRDNYGIPQVKSVTGNKILRILRAQGIATTIPEDLYFLIKKAVSM
TGO10014|RPS13       MGRMYGPGKGMSASALPWRRKPPTWLKIKP--SDVEEHIAKLAKKGQTPSQIGVTLRDSFGVPQVKSVTGNKILRILKLQGLAPELPEDLYYLIKKAVSV
GIA10014|Rps13       MGRMHSKGKGISRSAIPYTRAPAPWNKYTP--EDVCEQICKLAKKGTPPSRIGLILRDQFAIGQVKNVTGSKIVRILKAKGLAPEIPEDLYCMIKKAVAI


HUM10015|RPS13       RKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA---
DOG10014|Rps13       RKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA---
MUS10014|Rps13       RKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA---
RAT10014|Rps13       RKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA---
CHK10014|Rps13       RKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA---
FUG10014|RPS13       RKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLAPNWKYESSTASALVA---
DAN10014|Rps13       RKHLERNRKDKDAKFRLILVESRIHRLARYYKTRRVLAPNWKYESSTASALVA---
MED10014|Rps13       RKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLAPNWKYESSTASALVA---
CIO10014|RPS13       RKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA---
DRO10017|RpS13       RKHLERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALVA---
MOS10014|Rps13       RKHLERNRKDIDSKFRLILIESRIHRLARYYKIKAVLPPNWKYESSTASALVA---
BEE10014|Rps13       RKHLERNRKDKDSKFRLILVESRIHRLARYYKSKGTLPANWKYESSTASALVA---
CEL10014|rps-13      RKHLERSRKDIDSKYRLILVESRIHRLARYYKTKRQLPPTWKYESGTAASLVS---
BMA10014|RPS13       RKHLERNRKDKDSKYRLILVESRIHRLARYYKTKRQLPATWKYESSTASALVS---
STE10014|RPS13       RKHLEKNRKDKDSKFRLILIESRIHRLARYFKTKRVLPPNWKYESSTASALVA---
MBR10014|RPS13       RKHLDKNRKDKDCKFRLILVESRIHRLARYYKGAGVIPPNFKYQSATASALVS---
NEU10014|Rps13       RKHLERNRKDKDSKFRLILIESRIHRLARYYKTVGVLPPTWKYESSTASTIVS---
GRI10014|Rps13       RKHLERNRKDKDSKFRLILIESRIHRLARYYKTVGVLPPTWKYESATASTLVA---
GRA10014|Rps13       RKHLERNRKDKDSKFRLILIESRIHRLARYYKTVGVLPPTWKYESATASTIVA---
STA10014|Rps13       RKHLSTNRKDRDGKFRLILIESRIHRLSRYYKTVGVLPPTWRYESATASTLVA---
YAR10014|Rps13       RKHLDKNRKDADSKFRLILIESRIHRLARYYKSVGVLPPTWKYESATASALVN---
POM10025|RPS13       RKHLERNRKDKDSKFRLILIESRIHRLARYYRKVGALPPTWKYESATASALVA---
YST10023|RPS13       RKHLERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN---
CIN10014|Rps13       RKHLEVNRKDMDSKFRLILIESRIHRLARYYKSKQQIPPTFKYDSATASTLIA---
NEA10014|Rps13       RKHLERNRGDKDAKFRMILIESRIHRLARYYIKTQQVPATFKYEAATASTLVA---
MAY10014|Rps13       RKHLERNRKDMDSKFRLILIESRIHRLARYYKTKGAVAPTFKYEAATASTLVA---
RHI10054|Rps13       RKHLERNRKDKDSKYRLILIESRIHRLARYYKTSGQLPPTWKYESATASAMVA---
RHI10055|Rps13-2     RKHLERNRKDKDSKYRLILIESRIHRLARYYKTSGQLPPTWKYESATASAMVA---
RHI10056|Rps13-3     RKHLERNRKDKDSKYRLILIESRIHRLARYYKTSGQLPPTWKYESATASAMVA---
ARA10034|RPS13A      RKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA---
ARA10035|At4g00100   RKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA---
RIC10045|RPS13A      RKHLERNRKDKDSKFRLILVESRIHRLARYYKRTKKLPPTWKYESTTASTLVA---
RIC10046|RPS13A      RKHLERNRKDKDSKFRLILVESRIHRLARYYKRTKKLPPTWKYESTTASTLVA---
RIC10047|RPS13B      RKHLERNRKDKDTKFRLILVESRVHRLTRYYRLAKKIPAFFKYDSTTASTLVA---
GMA10067|RPS13       RKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA---
GMA10068|RPS13       RKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA---
GMA10069|RPS13       RKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA---
POP10014|RPS13       RKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA---
CRE10014|RPS13       RKHLERNRKDKDGKFRLILVESRIHRLARYYKRVRKLPPNWKYESSTASTLVS---
VOL10015|RPS13       RKHLERNRKDKDGKFRLILVESRIHRLARYYKRVRKLPPNWRYESSTASTLVS---
HEM10012|rps13       RKHLERNKKDKDSKFRLILVESKIHRVIRYYKKKKQISPNWKYESLSGASVKK---
PTR10014|RPS13       RKHLERNRKDKDSKFRLILIESRIHRLARYYRTTRKLPSNWKYESATASTIVS---
TPS10014|Rps13       RKHLERNRQDKDSKFRLILIESRIHRLARYYRTTRKLPANWKYESATASTMVA---
CYA10014|RPS13-2     RKHLERNRQDKDAKFRLILVESRIHRLARYYRRTGALPPTWKYESATAAQLVS---
CYA10015|RPS13       RKHLERNRQDKDAKFRLILVESRIHRLARYYRRTGALPPTWKYESATAAQLVS---
DIC10014|RPS13       NKHLQRARKDYDGKFHLRLVESRIHRLTRPYRKNGTLAPNWKYESNNASTLVA---
PLA10015|RPS13       RKHLEKNKKDKDCKFRLILTESKIHRISRYYKRKKLLPSNWKYQSSTASALIA---
TGO10014|RPS13       RKHLERNRKDKDAKFRLILVESRIHRLARYYKRTKQLPATWKYQSATASALVA---
GIA10014|Rps13       RKHLERSRRDKDSKFRLILVESRIHRLARYYRQARRLPPTFRYKSDQAAALLATYA