CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10011|VNG1132G    MSSEEQEDVDEDIQYFVRIGQTDLDGTKTVERALAELGGVGRRVARIVADEAGVDRTATMGGLEDDAIESVTDAVDSFTEHAP-AWLANRQNDFYTGENQ
MET10015|MJ0189      -------MQNSEFKYLIRVSRTDLDGNKKLIMALQDIYGVGEAMARAIVRVAKLDPNKLAGYLTEEEVKKIEEVLADPAKFGIPSWMFNRRKDYVTGEDK
PYR10011|PH1641      ---------MVDFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVSHGIPRWAVNRPKDYETGKDL
THE10013|TTHA1667    ---------------VARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEG-----------------
SYN10014|sll1816     ---------------VARIAGVDLPRDKRVEIALTYLYGIGLSRSHEILDATGVSPDVRVKDLSDEDALKLRTYIDENYEIEG-----------------
BAC10013|Bsu0141     ---------------MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRVRDLTEEELGKIRDIIDK-LKVEG-----------------
ECO10013|rpsM        ---------------VARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK-FVVEG-----------------
SUL10011|ST2070      ------MSQQQQFKYIVRLFGQDVDGTMKVPYALAMVKGIGYNTARAIVFKLGLDKDRRLGELSDEDIKKIENYLTDKKILEVPNWMYNRRKDYESGIDM


HAL10011|VNG1132G    HITGTDVELTRDQDINRMRMIRSYKGIRHERGQKVRGQRTKSTGRTEGTIGVNVEAIKEEQAEDDAADGGEE--------
MET10015|MJ0189      HVIESDLMIIKQEDINRLKRIRCYRGIRHELGLPCRGQRTKSTFRR--GPTVGVSRRKK---------------------
PYR10011|PH1641      HLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRR--GQTVGVSKKKK---------------------
THE10013|TTHA1667    -----ELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK-----------------
SYN10014|sll1816     -----DLRRWEAMNIKRLGDIGTYRGRRHRQGLPVRGQRTRTNARTRRGRRLTVAGKKKTPAKK----------------
BAC10013|Bsu0141     -----DLRREVSLNIKRLIEIGTYRGIRHRRGLPVRGQNSKNNARTRKGPRRTVANKKK---------------------
ECO10013|rpsM        -----DLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK------------------------
SUL10011|ST2070      HLVTSDLIFYVRNDIEREKKIKSWRGVRHSLGLKVRGQRTRTTGRT--GVTVGVRRSKAAQAAQQQQKAQASSGGEKKQG