CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10016|RPS14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALH
DOG10015|Rps14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALH
MUS10015|Rps14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALH
RAT10015|Rps14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALH
CHK10015|Rps14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALH
FUG10015|RPS14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALH
DAN10015|Rps14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQKCKELGITALH
MED10015|Rps14       ----MAPRKGK-EKKEEQVISLGPQVAE-GENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALH
CIO10015|RPS14       ----MAPRKAK-VEKTEEVVQLGPQVAE-GENVFGVAHIYASFNDTFVHVTDLSGKETIVRITGGMKVKADRDEASPYAAMLAAQDVAARCKEIGINALH
DRO10018|RpS14a      ----MAPRKAK-VQKEEVQVQLGPQVRD-GEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALH
DRO10020|RpS14b      ----MAPRKAK-VQKEEVQVQLGPQVRD-GEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALH
MOS10015|Rps14       ---MAPSRKNK-VAKEEVQVSLGPQVRD-GEVVFGVAHIYASFNDTFVHVTDLSGKETISRVTGGMKVKADRDEASPYAAMLAAQDVAEKCKSLGITALH
BEE10015|Rps14       ----MPPKRGK-VQKEEGQVSLGPQLRE-GEVVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKSLGITALH
CEL10015|rps-14      ---MAPARKGK-AKEEQAVVSLGPQAKE-GELIFGVAHIFASFNDTFVHITDISGRETIVRVTGGMKVKADRDESSPYAAMLAAQDVADRCKQLGINALH
BMA10015|RPS14       ----MPPRKGK-VKEDQPVVTLGPQAKE-GENIFGVAHIFASFNDTFVHVTDLSGRETIVRVTGGMKVKADRDEASPYAAMLAAQDVAERCKALSINALH
STE10015|RPS14       ----MAPRKGKKEVKEEQNISLGPQVVGEGELVFGVAHIFASFNDTFVHVTDLSGRETISRVTGGMKVKADRDEASPYAAMLAAQDVAARCKEIGITALH
MBR10015|RPS14       ----MAPKKTAAAPKEKEEVTLGPRVAD-GELVFGVAHIFASFNDTFVHVTDLSGKETISRVTGGMKVKADRDEASPYAAMLAAQDVAERCKQIGINALH
NEU10015|Rps14       ------MPPKKAARPAQENISLGPQIRE-GELVFGVARIFASFNDTFVHVTDLSGRETICRVTGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
GRI10015|Rps14       ------MPPKKTQRPAQENISLGPQVRE-GELVFGVARIFASFNDTFVHVTDLSGRETICRVTGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
GRA10015|Rps14       -----MPPKKTATRAPQENISLGPSVRD-GELVFGVARIFASFNDTFVHVTDLSGRETITRVTGGMKVKADRDESSPYAAMLAAQDVAARCKELGINALH
STA10015|Rps14       -----MPPKKKVERGAQENIQLGPQVRE-GELVFGVARIFASFNDTFVHITDLSGRETISRVTGGMKVKADRDESSPYAAMLAAQDVAARCKELGISALH
YAR10015|Rps14       ------------MAPKSDNVTLGPQARE-GELVFGVARIFASFNDTFVHITDLTGRETISRVTGGMKVKADRDENTPYAAMLAAQDAVEKAKEVGINALH
POM10026|RPS14-1     -----------------MATNVGPQIRS-GELVFGVAHIFASFNDTFVHITDLTGKETIVRVTGGMKVKTDRDESSPYAAMLAAQDAAAKCKEVGITALH
POM10027|RPS14-2     -----------------MATNVGPQIRS-GELVFGVAHIFASFNDTFVHITDLTGKETIVRVTGGMKVKTDRDESSPYAAMLAAQDAAAKCKEVGITALH
YST10024|RPS14A      -------------------MSNVVQARD-NSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVH
YST10025|RPS14B      ------------------MANDLVQARD-NSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVH
CIN10015|Rps14       -----MPPKKVKAPKEEAAVQLGPQVAD-GELVFGVAHIFASFNDTFVHVTDLSGRETITRVTGGMKVKADRDESSPYAAMLAAQDVAARCREVGITALH
NEA10015|Rps14       -----MAPKKVRAP-QEAAVSLGPQVAE-GENVFGVAHIFASFNDTFVHVTDLTGKETISRVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITALH
MAY10015|Rps14       -------MAPKVRAAATNEVSLGPNVGE-GELVFGVAHIFASFNDTFVHVTDMSGKETVVRVTGGMKVKADRDESSPYAAMLAAQDCAVRCKEVGITALH
RHI10057|Rps14       ------MSNKKAAPKVVEKVTLGPQVRE-GELVFGVAHIFASFNDTFVHVTDLSGRETISRITGGMQVKADRDESSPYAAMLAAQQVAAKCKELGINALH
RHI10059|Rps14-2     ------MSNKKAAPKVVEKVTLGPQVRE-GELVFGVAHIFASFNDTFVHVTDLSGRETISRITGGMQVKADRDESSPYAAMLAAQQVAAKCKELGINALH
RHI10060|Rps14-3     -------MSKKAAPKVVEKVTLGPQVRE-GELVFGVAHIFASFNDTFVHVTDLSGRETISRITGGMQVKADRDESSPYAAMLAAQQVAAKCKELGINALH
ARA10036|RPS14A      ------MSKRKTKEPKVDVVTLGPSVRE-GEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITAMH
ARA10037|RPS14B      ------MSKRKTKEPKVETVTLGPSVRE-GEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITAMH
ARA10038|RPS14C      ------MSKRKTKEPKVENVTLGPAVRE-GEQVFGVVHVFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITAIH
RIC10049|RPS14B      ------MSKRKTREPKEENVTLGPTVRE-GEYVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLASQDVAQRCKELGITALH
RIC10050|RPS14A      -----MSGRKKTREPKEENVTLGPTVRE-GEYVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLASQDVAQRCKELGITALH
RIC10051|RPS14A      -----MSGRKKTREPKEENVTLGPTVRE-GEYVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLASQDVAQRCKELGITALH
RIC10052|RPS14A      -----MSGRKKTREPKEENVTLGPTVRE-GEYVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLASQDVAQRCKELGITALH
GMA10072|RPS14       ------MSRRKVREPKEENVTLGPAVRD-GEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
GMA10073|RPS14       ------MSRRKVREPKEENVTLGPAVRD-GEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
GMA10074|RPS14       ------MSRRKVREPKEENVTLGPAVRD-GEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
GMA10075|LOC10030656 ------MSRRKVREPKEENVTLGPAVRD-GEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
GMA10076|LOC10049966 ------MSRRKVREPKEENVTLGPAVRD-GEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
GMA10077|LOC10078060 ------MSRRKVREPKEENVTLGPAVRD-GEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALH
POP10015|RPS14       ------MSRRKTREPKEENVTLGPTVRE-GEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVSQRCKELGITALH
CRE10015|RPS14       ---MAPKKAAKGDEAPKEVVSLGPTVRE-GEHVFGVAHIFASFNDTFVHVTDLSGRETISRVTGGMKVKADRDESSPYAAMLAAQDVAQKCKELGITALH
VOL10016|RPS14       ---MAPKKSAKADDAPKEVVSLGPTVRE-GEHVFGVAHIFASFNDTFVHVTDLSGRETISRVTGGMKVKADRDESSPYAAMLAAQDVAQKCKELGITALH
HEM10013|rps14       ---------------MKNLKNSGAEIGN--ELKFGIVHIFASFNDTFIHVTDLSGSETLIRRTGGMEVKADRDESSPYAAMVAAQKVAERCKEIGINALH
PTR10015|RPS14       -----------MSGEEPTQTMGGVKLQE-GEEVFGVAHLFASFNDTFVHVTDLSGRETLVRVTGGMKVKADRDESSPYAAMLAAQDVAVRCKELGITALH
TPS10015|Rps14       ------------MAETEANPELAPKTIE-GEEVFAVAHLFASFNDTFVHVTDLSGRETLVRVTGGMKVKADRDESSPYAAMLAAQDVAARCKELGVTALH
CYA10016|RPS14       ------MASKKRQAVVSEEVSQGPQLRE-GEECFAVCHIYASFNDTFIHVTDLSGRETFVRRSGGMEVKADRDESSPYAAMIATQKVAERCKELGITALH
DIC10015|RPS14       MSGKKEVKAPKVVEALSAKIPCGP-----SELVFGVAHIFASFNDTFVHVTDLSSKETIVRVTGGMKVKTDRDESSPYAATMAAQDVALRCKELGVTALH
PLA10017|RPS14       -----MASKKVKTPQPETAIVSGPQPKE-GELVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMMAAQDVAARLKELGVTAIH
TGO10015|RPS14       MAPKKSAKAATGEEGEAQGSGLGPATRD-GEIVFGVAHIYASFNDTFIHVTDLSGRETLVRVTGGMKVKADRDESSPYAAMMAAADVAARCKELGISAVH
GIA10015|Rps14       ------------MSRKVTYAPENLPAKNNNSEAFAVCHIYAGKNDTFIHVTDLSGRETIGRVSGGMKVKRHCDEPSAYAAMQATQDLIEIITDRGITAVH


HUM10016|RPS14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
DOG10015|Rps14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
MUS10015|Rps14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
RAT10015|Rps14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
CHK10015|Rps14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
FUG10015|RPS14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
DAN10015|Rps14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
MED10015|Rps14       IKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
CIO10015|RPS14       IKLRATGGTRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDHTRRKGGRRGRRL
DRO10018|RpS14a      IKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRRL
DRO10020|RpS14b      IKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRRL
MOS10015|Rps14       IKLRATGGNRTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRRL
BEE10015|Rps14       IKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGRRL
CEL10015|rps-14      IKLRATGGTRTKTPGPGAQSALRALARAGMKIGRIEDVTPIPSDCTRRKGGRRGRRL
BMA10015|RPS14       IKLRATGGTKTKTPGPGAQSALRALARSGIKIGRIEDVTPIPTDCTRRKGGRRGRRL
STE10015|RPS14       IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
MBR10015|RPS14       VKLRATGGNRTKTPGPGAQSALRALARAGMKIGRIEDVTPIPSDSTRKKGGRRGRRL
NEU10015|Rps14       IKIRATGGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDSTRRKGGRRGRRL
GRI10015|Rps14       IKIRATGGNGTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDSTRRKGGRRGRRL
GRA10015|Rps14       IKIRATGGNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDSTRRKGGRRGRRL
STA10015|Rps14       VKIRATGGNGTKTPGPGAQSALRALARAGMRIGRIEDVTPTPSDSTRRKGGRRGRRL
YAR10015|Rps14       IRIRATGGTSTKTPGPGCQSAVRALARAGMRIGRIEDVTPVPSDSTRRKGGRRGRRL
POM10026|RPS14-1     IKIRATGGTATKTPGPGAQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGRRGRRL
POM10027|RPS14-2     IKIRATGGTATKTPGPGAQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGRRGRRL
YST10024|RPS14A      VKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL
YST10025|RPS14B      VKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL
CIN10015|Rps14       IKLRATGGTGTKTPGPGAQSALRALARAGMRIGRIEDVTPVPTDSTRRKGGRRGRRL
NEA10015|Rps14       VKLRATGGTGTKQPGPGGQAALRALARAGMRIGRIEDVTPTPSDSTRRKGGRRGRRL
MAY10015|Rps14       IKLRATGGTGTKTPGPGAQAALRALARAGMRIGRIEDVTPVPTDSTRRKGGRRGRRL
RHI10057|Rps14       IKLRATGGTGTKTPGPGGQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGRRGRRL
RHI10059|Rps14-2     IKLRATGGTGTKTPGPGGQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGRRGRRL
RHI10060|Rps14-3     IKLRATGGTGTKTPGPGGQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGRRGRRL
ARA10036|RPS14A      VKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL
ARA10037|RPS14B      VKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL
ARA10038|RPS14C      VKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL
RIC10049|RPS14B      IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL
RIC10050|RPS14A      IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL
RIC10051|RPS14A      IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL
RIC10052|RPS14A      IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL
GMA10072|RPS14       IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
GMA10073|RPS14       IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
GMA10074|RPS14       IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
GMA10075|LOC10030656 IRLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
GMA10076|LOC10049966 IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
GMA10077|LOC10078060 IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
POP10015|RPS14       IKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL
CRE10015|RPS14       IKLRATGGNRTKTPGPGAQSALRALARAGMKIGRIEDVTPIPTDSTRRKGGRRGRRL
VOL10016|RPS14       IKLRATGGNRTKTPGPGAQSALRALARAGMKIGRIEDVTPIPTDSTRRKGGRRGRRL
HEM10013|rps14       IKLRATGGNRSRTPGPGAQSAIRSLARSGIKIGRIEDVTPIPTDGTRRKGGRRGRRL
PTR10015|RPS14       IKVRGTGGNKSKSPGPGAQSALRALARNGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
TPS10015|Rps14       IKVRGTGGSKSRSPGPGAQSALRALARNGMKIGRIEDVTPIPSDSTRRKSGRRGRRL
CYA10016|RPS14       IKVRGTGGSKAKTFGPGAQAAIRALARSGMKIGRLEDVTPIPHDGTRRKGGRRGRRL
DIC10015|RPS14       IKLRATGGNGSKTPGPGAQSALRALARSGMRIGRIEDVTPIPTDSTRRKSGHRGRRL
PLA10017|RPS14       IKLRASGGTKSKTPGPGAQSALRALARSGLKIGRIEDVTPIPTDSTRKKSGRRGRRL
TGO10015|RPS14       VKVRAAGGTRSKTPGPGAQSALRALARSGLRIGRIEDVTPIPTDSTRRKSGRRGRRL
GIA10015|Rps14       IKIRADGGTGKRVYGQGGSAAIRALVRGGIKIGRIEDSTPIPTDRTRHKGGRRGRRL