CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10012|VNG1706G    -----MSETDGEA---------------------------------------EETGQTHECRRCGREQG-LVGKYDIWLCRQCFREIARSMGFKKYS---
MET10016|rpsN        -MAKKPWKK-------------------------------------------KYGYGIRPCQRCGHVGPGLIRKYGLNLCRQCFREIAHKLGFKKLD---
PYR10012|PHS047      -MAKADYNKRKPR---------------------------------------KFGKGARRCIRCGQYGP-IIRIHGLMLCRHCFREVAPKLGFRKYE---
THE10014|TTHA1679    MARKALIEKAKR----------------------------------------TPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS
SYN10015|slr0628     MAKKSMIERDKRRSRLVAKYAAKREALKEEFR-QAETLEDKLAVHQKLQDLPRNSAPNRRRNRCQVTGRPRSYYRDFGLCRNVLREWAHQGLLPGVTKSS
BAC10014|Bsu0887     LAKKSKVAKELKRQQLVEQYAGIRRELKEKG------------DYEALSKLPRDSAPGRLHNRCMVTGRPRAYMRKFKMSRIAFRELAHKGQIPGVKKAS
ECO10014|rpsN        MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKAS
SUL10012|STS059      VREMGKYKPPAER---------------------------------------KYGRGVQVCRRCGSRDS-VIQKYGLYLCRQCFREVAYEMGFKKTR---


HAL10012|VNG1706G    -
MET10016|rpsN        -
PYR10012|PHS047      -
THE10014|TTHA1679    W
SYN10015|slr0628     W
BAC10014|Bsu0887     W
ECO10014|rpsN        W
SUL10012|STS059      -