CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10018|RPS15A      MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFG
DOG10017|Rps15a      MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFG
MUS10017|Rps15a      MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFG
RAT10017|Rps15a      MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFG
CHK10017|Rps15a      MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFG
FUG10017|RPS15A      MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDLQLKDLEKWQNNLLPSRQFG
DAN10017|Rps15a      MVRMNVLADALKSINNAEKRGKRQVLLRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFG
MED10017|Rps15a      MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDLQLKDLEKWQNNLLPSRQFG
CIO10017|RPS15A      MVRMNVLADALKCLCNAEKRGKRQVLLRPCSKVVVKFLTVMMKHGYINEFTIVDDHRAGKIVVELNGRLNKCGVISPRFDVAIRDLEKWTTNLLPSRQFG
DRO10022|RpS15Ab     MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNLTGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFG
DRO10024|RpS15Aa     MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGKIVVNLTGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFG
MOS10017|Rps15a      MVRISVLADALKCINNAEKRGKRQVLIRPNSKVVIKFLTVMMKHGYIGEFEIVDDHRSGKVVVNLTGRLNKAGIISPRFDVALNDIERWTNNLLPSRQFG
BEE10017|Rps15a      MVRMNVLSDALKSINNAEKRGKRQVLLRPCSKVIIKFLTVMMRKGYIGEFEIVDDHRSGKVVVNLSGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFG
CEL10017|rps-22      MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGKIVVNLTGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFG
BMA10017|RPS15A      MVRMSVLADALKTINNAEKRGKRQVLIRPCSKVIVRFLTVMMKAGYIGEFEIIDDHRAGKIVVNLTGRINKCSVISPRFDISLKDLEKWTSNLLPSRQFG
STE10017|RPS15A      MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKHGYIGEFVIVDDHRAGKIIVNLTGRLNKCGVISPRFDVGVRDIEQWASNLLPSRQFG
MBR10017|RPS15A      -MRMSVLNDALRVMTNAEKRGKRQAMIRPASKVVVKFLQVMMKHGYIDEFEFVDDHRAGKIVVQLNGRLNKCGVISPRFDVKVKEIEKWVNNLLPSRQFG
NEU10017|Rps15a      MVRTSVLHDALNSINNAEKAGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEEVDDHRSGKIVVQLNGRMNKCGVISPRYNVRLAELEKWVVKLLPARQFG
GRI10017|Rps15a      MVRTSVLNDALKSINNAEKAGKRQVMIRPSSKVITKFLSVMQKHGYIGEFEELDDHRSGKIVVQLNGRLNKTGVISPRYNVRLADLEKWVVKLLPARQFG
GRA10017|Rps15a-1    MVRTSVLHDALNAMNNAEKAGKRQVLIRPSSKVIIKFLTVMQRHGYIGEFEEIDDHRSGKIVVQLNGRLNKVGVISPRYNVRLAELEKWVVKLLPARQFG
GRA10018|Rps15a-2    MVRTSVLSDALKNINNAEKAGKRQVLLRPSCKVVVKFLELMQAQGYIGEFEELSDNRSGKIVVQLNGRLNKCGVISPRFNVRLGELEKWVVRLLPARQFG
STA10017|Rps15a      MVKTSVLNDCLNAINNAEKAGKRQVLIRPSSKVIVKFLTVMQRHGYIGEFEEVDDHRNGKIIIQLNGRINKTGVISPRYNVQLRDMEKWVVKLLPSRQFG
YAR10017|Rps15a-1    MTRTSVLADALQSITNAEKAGKRQVLIRPSSKVIIKFLTVMQQHGYIGEFEYVDDHRSGKIVVQLNGRLNKCGVISPRFNVKIDDVEKWIQNLLPSRQFG
YAR10018|Rps15a-2    MTRTSVLADALKSITNAEKAGKRQVLIRPASKVIIKFLQVMQKHGYINEFTYVDDHRSGKIVVELNGRLNKCGVISPRFNVKIDDMEKWVQNLLPSRQFG
POM10030|RPS15A-1    MVRQSVLADCLNNIVNAERRGRRQVLIRPSSKVIVKFLTVMQKHGYIDEFTEIDDHRSGKIVIQLNGRINKCGVISPRFNVKLKDIEKWVNQLLPSRQVG
POM10031|RPS15A-2    MVRQSVLADCLNNIVNAERRGRRQVLIRPSSKVIVKFLTVMQKHGYIDEFTEIDDHRSGKIVIQLNGRINKCGVISPRFNVKLKDIEKWVNQLLPSRQVG
YST10027|RPS22A      MTRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFG
YST10028|RPS22B      MTRSSVLADALNAINNAEKTGKRQVLLRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFG
CIN10017|Rps15a      MVRISVLNDCLNNIVNAERRGKRQVLIRPSSKVVVKFLSVMQRHGYIGEFEIIDDHRAGKIVVQLNGRLNKTGVISPRFNVQVTQIESWVNLLLPARGFG
NEA10017|Rps15a      MVRVSVLNDALNNIVNAERRGKRQVLIRPSSKVVIKVLSVMQKHGYIGEFEIIDDHRGGKVVIQLNGRLNKCGVISPRFNVPVDSIENWVSQLLPARSFG
MAY10017|Rps15a      MVRISVLNDALNSIVNAERKGKRQVLVRPSSKVVIKFLSVMQKHGYIGEFEEVDDHRSGKVVIQLNGRINKCGVISPRFNVQLGQIENWVQQLLPARSFG
RHI10058|Rps15a      MVRVSVLNDCLNNINNAERRGKRQVLIRPSSKVIIKFLSVMQKHGYIGEFEEIDDHRSGKIVIQLNGRLNKCGVISPRFNIKLTELEKWTANLLPARQFG
RHI10065|Rps15a-2    MVRVSVLNDCLNNINNAERRGKRQVLIRPSSKVIIKFLSVMQKHGYIGEFEEIDDHRSGKIVIQLNGRLNKCGVISPRFNIKLTELEKWTANLLPARQFG
RHI10066|Rps15a-3    MVRVSVLNDCLNNINNAEKRGKRQVMVRPCSKVIVKFLSVMQKHGYIGAFEIIDDHRNGKIVIELVGRLNKCGVISPRFNIKLTDIEKLTANLLPARQFG
ARA10045|RPS15Aa     MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
ARA10048|RPS15Ad     MVRISVLNDGLKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
ARA10049|RPS15Ae     -MGRRILNDALRTIVNAERRGKASVELKPISTVMSSFLRIMKEKGYIKNFQVYDPHRVGRITVDLQGRVNDCKALTYRQDVRAKEIEKYTERTLPTRQWG
ARA10050|RPS15Af     MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
RIC10056|RPS15Aa     MVRVSVLNDALKTMYNAEKRGKRQVLIRPSSKVIIKFLIVMQKHGYIGEFEFVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIESWTARLLPSRQFG
RIC10058|RPS15Ae     -MGRRILNDALRTMVNAERRGKATALLQPISGVMVSFLNIMKHRGYIKKFEVIDPHRVGKINVELHGRIKDCKALTYRQDIRAKEIEQYRVRMLPTRQWG
GMA10081|LOC10030564 MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
GMA10082|LOC10079867 MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
GMA10083|LOC10080682 MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
GMA10084|LOC10052784 MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
GMA10085|LOC10079997 MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG
GMA10087|LOC10079218 -MGRRILNDALRSMVNAERRGKALVELKPISTVMSSFLQIMKHHGYIKDFQVYDPHRVGRIRVELQGRINDCKALSHRKDLKARDIEAYRLQTLPTHQWG
GMA10088|LOC10030636 -MGRRILNDALRSMVNAERRGKSMVELKPISTVMSSFLQIMKHHGYIKDFQVYDPHRVGRISVELQGRINDCKALMHRKDLKARDIEAYRLQTLPTHQWG
POP10017|RPS15A      MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEFVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIETWTARLLPSRQFG
CRE10017|RPS15A      MVRISVLGDALKTMYNAEKRGKRQVLLRPASKVVIKFLSLMMKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVISPRYDIGHSEIERWVARLLPSRQFG
VOL10018|RPS15A      MVRISVLGDALKTMYNAEKRGKRQVLLRPASKVVIKFLSLMMKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRYDIGHAEIEAWVARLLPSRQFG
HEM10015|rps15A      MSKVNLLADALKTISNAERSGKKQVLIRPCSKIIIKFLQVMQSNGYVDKFTFIDDNRSGKIVVNLLGRINKCRAISPRYDIKIKDSEKWISNILPSRQFG
PTR10017|RPS15A      MVRMSVLADCLKTISNAEKRGRRQVLIRPSSKVVIKFLQKMQEHGYIGEFEIIDDHRANKIVVELNGRLNKCGVISPRFDVKVDEIEKWIVNLLPSRQFG
TPS10017|Rps15a      MVRMSVLADCLKTITNAEKRGKRQVLIRPSSKVIVKFLQCMQQNGYIGEFEIVDDHRSQKIVIELNGRLNKCGVISPRFDVQVHEIEKWVVNLLPSRQFG
CYA10018|RPS15A      MTRVNVLSDALKSITNAEKRGKRQVMIRPASKVIIRVLRLLQREGYIGDFTFIDDHRSGKIVVQLIGRLNKVAVISPRYDVAIRDLQKWCDALLPSKLFG
DIC10017|RPS15A      MVRISVLNDCLNSIVNAERQGKRQVLVRPSSKVIVKFLEVMMKKRYIGEFEIVDDHRSGKIVIDLIGRINKCGVISPRFDVTLDEIEKWASYLLPSRQFG
PLA10019|RPS15A      MVRMSVLADCLKTINNAEKRGRRQVLIRPSSKVVIKFLQYMQKKGYIGSFEIVDDHRSGKIVVNLLGRINKCAVISPRYDVKLDEIEKIITSILPSRLFG
TGO10017|RPS15A      MVRMNVLADCLKTLVNAEKRGRRQVLIRPSSKVIIKFLQCMQRRGYIGDFEIVDDHRAGKIVIELLGRINKCGVISPRFDIQVDKIEQFCSNLLPSRQFG
GIA10017|Rps15a      MVRINVLRDALKSICNAQRIGKKQVIVRPSSKVIIEFLQLMQKNGYISDFAVVDNHRSNRIVVNLIGRLNKAGVISPRFDIPANDIEKWVVNLLPSRLFG


HUM10018|RPS15A      FIVLTTSAGIMDHEEARRKHTGGKILGFFF
DOG10017|Rps15a      FIVLTTSAGIMDHEEARRKHTGGKILGFFF
MUS10017|Rps15a      FIVLTTSAGIMDHEEARRKHTGGKILGFFF
RAT10017|Rps15a      FIVLTTSAGIMDHEEARRKHTGGKILGFFF
CHK10017|Rps15a      YIVLTTSAGIMDHEEARRKHTGGKILGFFF
FUG10017|RPS15A      YIVLTTSAGIMDHEEARRKHTGGKILGFFF
DAN10017|Rps15a      FIVLTTSAGIMDHEEARRKHTGGKILGFFF
MED10017|Rps15a      YIVLTTSAGIMDHEEARRKHTGGKILGFFF
CIO10017|RPS15A      YIVLTTSCGIMDHEEARRKHTGGKILGFFF
DRO10022|RpS15Ab     YVVLTTSGGIMDHEEARRKHLGGKILGFFF
DRO10024|RpS15Aa     YVVLTTSGGIMDHEEARRKHLGGKILGFFF
MOS10017|Rps15a      YVVLTTSGGIMDHEEARRKHLGGKILGYFF
BEE10017|Rps15a      YVVLTTSGGIMDHEEARRKHLGGKILGFFF
CEL10017|rps-22      YLILTTSAGIMDHEEARRKHLGGKILGFFF
BMA10017|RPS15A      HLVLTTSGGIMDHEEARRKHLGGKILGFFF
STE10017|RPS15A      FLVLTTSTGIMDHEEARRKHTGGKILGFFY
MBR10017|RPS15A      HIVLTTADGIMDHEEARRKHTGGKILGFFY
NEU10017|Rps15a      YVILTTSAGIMDHEEARRKHVSGKIIGFFY
GRI10017|Rps15a      YVILTTSAGIMDHEEARRKHVAGKIIGFFY
GRA10017|Rps15a-1    YVILTTSAGIMDHEEARRKHVSGKIIGFFY
GRA10018|Rps15a-2    HIVLTTSSGIMVHESARRKHVSGKIIGFFY
STA10017|Rps15a      YIVLTTSAGIMDHEEARRKHVAGKILGFFY
YAR10017|Rps15a-1    YIILTTSAGIMDHEEARRRHVAGKILGFFY
YAR10018|Rps15a-2    YIILTTSAGIMDHEEARRRHVAGKILGFFY
POM10030|RPS15A-1    VIVLTTSRGIMSHNEARAKDAGGKILGFFY
POM10031|RPS15A-2    VIVLTTSRGIMSHNEARAKDAGGKILGFFY
YST10027|RPS22A      YVILTTSAGIMDHEEARRKHVSGKILGFVY
YST10028|RPS22B      YVILTTSAGIMDHEEARRKHVSGKILGFVY
CIN10017|Rps15a      IIILTTSSGILDHEEARRKNVGGKLLGYVY
NEA10017|Rps15a      KIILTTSAGIMDHVEARNKHVGGKILAFVY
MAY10017|Rps15a      YVVLTTSAGIMDHEEARRKHVAGKILGFFY
RHI10058|Rps15a      YLILTTSAGIMDHEEARQKHAGGKILGFFY
RHI10065|Rps15a-2    YLILTTSAGIMDHEEARQKHAGGKILGFFY
RHI10066|Rps15a-3    YLVLTTSAGIMDHNEARQKHVGGNILGFFY
ARA10045|RPS15Aa     YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
ARA10048|RPS15Ad     FIVLTTSAGIMDHEEARRKNVGGKVLGFFY
ARA10049|RPS15Ae     YVVITTPDGILDHEEAIKRNVGGQVLGFFY
ARA10050|RPS15Af     YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
RIC10056|RPS15Aa     YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
RIC10058|RPS15Ae     YVVITTPNGVLDHEEAIKQNVGGQVLGYFH
GMA10081|LOC10030564 YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
GMA10082|LOC10079867 YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
GMA10083|LOC10080682 YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
GMA10084|LOC10052784 YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
GMA10085|LOC10079997 YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
GMA10087|LOC10079218 YVVITTPDGILDHEEAIRKNVGGQVLGYFH
GMA10088|LOC10030636 YVVITTPDGILDHEEAIRKNVGGQVLGYFH
POP10017|RPS15A      YIVLTTSAGIMDHEEARRKNVGGKVLGFFY
CRE10017|RPS15A      IIVMTTSAGIMDHEEARRKRVGGKVLGFFY
VOL10018|RPS15A      VIVMTTSAGIMDHEEARRKRVGGKVLGFFY
HEM10015|rps15A      IIVLSTSYGIMGHKEAFLKKTGGKILGFFY
PTR10017|RPS15A      HILISTTYGIMTHEEARRKKTGGKILGFFY
TPS10017|Rps15a      QIILSTTFGIMTHEEARRKKTGGKVLGFFY
CYA10018|RPS15A      GLICTTSSGIMNDAEMRRRHVGGKLIGFYY
DIC10017|RPS15A      HIVLTTSLGIMDHNEAKTRHTGGKLLGFFY
PLA10019|RPS15A      HLILTTPYGIMDHEEARRKHTGGKVLGFFF
TGO10017|RPS15A      HLVLTTAYGIMDHEEARRKHTGGKILGYFF
GIA10017|Rps15a      HIILTTSQGIMDHIEAQHRQIGGKVIGYFY