CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10013|VNG0790G    MARMHTRRRGSSGSDRPTADEPPEWSDVDEDAIEERVVELAEQGHDPSQIGLKLRDEGVQGTPVPDVKLATG-------KKVTEILEAHDAEPELPEDFR
MET10017|MJ0036      MARMHARKRGRSGSKRPVRKEVPEWVQYTPEQVEQLVVELAKKGYQSAQIGLILRDT----YGIPDVKLITG-------KKISKIMKEHGLYPKVPEDLL
PYR10040|PH0058      MARMHARKRGKSGSKRPPRTAPPIWLDYTVEDIENLVVKLRKEGYSTAMIGTILRDQ----YGIPTVKLFRDPDNPNRKLTITRILEKHGLAPEIPEDLM
THE10015|TTHA1138    ------------------------------------------------MPITKEEKQ----------------------KVIQEFARFPGDTGSTEVQVA
SYN10016|ssl1784     ------------------------------------------------MSLTQIRKQ----------------------ELMTEYQAHETDTGSADLQVA
BAC10015|Bsu1669     ------------------------------------------------MAITQERKN----------------------QLINEFKTHESDTGSPEVQIA
ECO10015|rpsO        ------------------------------------------------MSLSTEATA----------------------KIVSEFGRDANDTGSTEVQVA
SUL10042|ST0384      --VNKKRPNGKSHSTRPVRSGAPKWVRFTREEVELLVEELAKKGYSPSMIGIILRDQ----YGIPLVKQITG-------KKLTKILEEKGLAPKIPEDLF


HAL10013|VNG0790G    NLLEKAVRLHEHVEANGQDHQNKRALQNTQSKIRRLADYYRG-DKLDEEFAYSYETAREIIEE---
MET10017|MJ0036      NLMRRAVNLRKHLEQHPKDLHSKRGLQLIESKIRRLVKYYKSKGVLPADWRYTPETARLLVEQA--
PYR10040|PH0058      FLIRRAVNLRKHLEQHPKDLHSMRGLQLIESKIRRLVKYYKRKGKLPRDWRYDPEQAKLLVR----
THE10015|TTHA1138    LLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQR----EDPERYRALIEKLGIRG---
SYN10016|ssl1784     FLTERITQLTGHLKANPKDHASRRGLLKMIGRRKRLLSFINA----REPERYQALIKRLGIRR---
BAC10015|Bsu1669     ILTDSINNLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYLRN----KDVTRYRELINKLGLRR---
ECO10015|rpsO        LLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKR----KDVARYTQLIERLGLRR---
SUL10042|ST0384      NLIRKAANVRRHLFEHPKDKRAKKGLEEIESKIRRLADYYKRIGKLPKEWKYEPEKAELLASGAAS