CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10020|RPS17       ---MGRVRTKTVKKAARVIIEKYYTRLG-NDFHTNKRVC--EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD--
DOG10019|Rps17       ---MGRVRTKTVKKAARVIIEKYYTRLG-NDFHTNKRVC--EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD--
MUS10019|Rps17       ---MGRVRTKTVKKAARVIIEKYYTRLG-NDFHTNKRVC--EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD--
RAT10019|Rps17       ---MGRVRTKTVKKAARVIIEKYYTRLG-NDFHTNKRVC--EEIAIIPSKNLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD--
FUG10019|RPS17       ---MGRVRTKTVKKAARVIIEKYYTRLG-SDFHTNKRVC--EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD--
DAN10019|Rps17       ---MGRVRTKTVKKAARVVIEKYYTRLG-NDFHINKRVC--EEIAIIPSKPLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD--
MED10019|Rps17       ---MGRVRTKTVKKAARVIIEKYYTRLG-NDFHTNKRVC--EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALD--
CIO10019|RPS17       ---MGRVRTKTVKKAARVIIEKYYMKLT-LDFHTNKRVC--EEIAIIPSKKLRNQIAGFVTHLMKRIRVGPVRGISIKLQEEERERRDNYVPDVSALD--
DRO10026|RpS17       ---MGRVRTKTVKKAAKVIIEKYYTRLT-LDFHTNKRIC--EEVAIIPTKPLRNKIAGYVTHLMGRLRHSQVRGISIKLQEEERERRDNYVPAVSALE--
MOS10019|Rps17       ---MGRVRTKTIKKASKVIIEKYYTRLT-MDFDTNKRIV--EEVAIIPTKPLRNKIAGFVTHLMKRLRHSQVRGISIKLQEEERERRDNYVPDVSALE--
BEE10019|Rps17       ---MSRVRTKTVKKAAKLIIEKYYTRLT-MDFHTNKRIC--EEIAIIPSKSLRNKIAGFVTHLMKRLRHSQVRGISIKLQEEERERRDNYVPEVSALE--
CEL10019|rps-17      ---MSRVRTKTVKKASRVLIEKYYTRMT-NDFHNNKRVC--DEVAIIGSKPLRNKIAGYITHLMRRIERGPVRGISIKLQEEERERRDNYMPEISTVDPS
BMA10019|RPS17       -MVCGRVRTKTVKKASRVIIEKYYTKLT-HDFHTNKRIC--EEIAVIPSKKMRNRIAGYITHLMKRIEKGPVRGISIKLQEEERERRDNYMPDISVVDPR
STE10019|RPS17       ---MGRVRTKTVKKAARVIIEKYYTRLT-LDFHTNKRVC--EEIAIIPSKKLRNKIAGFVTHLMKRIQKGAVRGISIKLQEEERERRDNYVPEVSALE--
MBR10019|RPS17       ---MGRVRTKTVKRAARVIIEKYYTRLT-MDFDTNKRLV--EEYAIVPSKRLRNKIAGFITHLMKRIQKGPVRGISIRLQEEERERRDNYVPEVSALEPG
NEU10019|Rps17       ---MGRVRTKTVKKSAKVIIERYYPKLT-LDFETNKRIC--DEIAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDFT
GRI10019|Rps17       ---MGRVRTKTVKKSAKVIIERYYPRLT-LDFETNKRIC--DEIAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQFVPEVSALDFS
GRA10020|Rps17       ---MGRVRTKTVKKSAKVIIERYYPRLT-LDFETNKRIC--DEIAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQFVPEVSALDFT
STA10019|Rps17       ---MGRVRTKTVKKSAKVIIERYYPKLS-LDFETNKRIC--DEIAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEISALDFT
YAR10020|Rps17       ---MGRVRTKTVKRASKVMIERYYPKLT-LDFETNKRLA--DEIAVIPSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEISALDLS
POM10034|RPS17-1     ---MGRVRTKTTKRASRVVIEKYYPRLT-LDFQTNKRIV--DEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSELEVD
POM10035|RPS17-2     ---MGRVRTKTTKRASRVVIEKYYPRLT-LDFQTNKRIV--DEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSELEKD
YST10031|RPS17A      ---MGRVRTKTVKRASKALIERYYPKLT-LDFQTNKRLC--DEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLS
YST10032|RPS17B      ---MGRVRTKTVKRASKALIERYYPKLT-LDFQTNKRLC--DEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLS
CIN10019|Rps17       ---MGRVRTKTVKRASRVLIEKYYPRLT-LDFHTNKRII--DEVAVVPSKRLRNKISGFTTHLMKRIQKGPVRGISFKLQEEERERKDNYIPEVSALDTS
NEA10019|Rps17       ---MGRVRTKTVKRSSRILIERYYPRLT-LDFHSNKRIL--DEVATVPSKRLRNKIAGFTTHLMKRIQKGPVRGISFRLQEEERERKDQYVPEVSALAAS
MAY10019|Rps17       ---MGRVRTKTTKRASRVLIEKYYPRLSNVDFHQNKRVI--DEVAIIPSKRLRNKIAGFTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDTS
RHI10072|Rps17       ---MGRVRTKTVKKASRVVIEKYYPRLT-LDFQVNKKIL--DEVTIIQSKRLRNKIAGFTTHLMKRISRGPVRGISFKLQEEERERRDNYVPEFSALDTS
RHI10073|Rps17-2     ---MGRVRTKTVKKASRVVIEKYYPRLT-LDFQVNKKIL--DEVTIIQSKRLRNKIAGFTTHLMKRISRGPVRGISFKLQEEERERRDNYVPEFSALDTS
RHI10074|Rps17-3     ---MGRVRTKTVKKASRVVIEKYYPRLT-LDFQVNKKIL--DEVTIIQSKRLRNKIAGFTTHLMKRISRGPVRGISFKLQEEERERRDNYVPEFSALDTS
ARA10054|RPS17A      ---MGRVRTKTVKKSSRQVIEKYYSRMTL-DFHTNKKIL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDESAIKTD
ARA10055|At2g05220   ---MGRVRTKTVKKSSRQVIEKYYSRMTL-DFHTNKKIL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDESAIKTD
ARA10056|RPS17C      ---MGRVRTKTVKKSSRQVIEKYYSRMTL-DFHTNKKIL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDESAIKID
ARA10057|RPS17D      ---MGRVRTKTVKKSSRQVIEKYYSRMTL-DFHTNKKIL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDESAIKTD
RIC10063|RPS17A      ---MGRVRTKTVKKTSRQVIEKYYSRMTL-DFHTNKKVL--EEVSILPSKRLRNKVAGFTTHLMRRIQRGPVRGISLKLQEEERERRMDFVPEKSALEVE
RIC10064|RPS17D      ---MGRVRTKTVKKTSRQVIEKYYSRMTL-DFHTNKKVL--EEVSILPSKRLRNKVAGFSTHLMRRIQRGPVRGISLKLQEEERERRMDFVPDRSALEVD
GMA10093|LOC10078540 ---MGRVRTKTVKKSSRQVIERYYSRMTL-DFHTNKKVL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDVSAIRTD
GMA10094|LOC10052703 ---MGRVRTKTVKKSSRQVIERYYSRMTL-DFHTNKKLL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDVSAINTD
GMA10095|LOC10081906 ---MGRVRTKTVKKSSRQVIERYYSRMTL-DFHTNKKVL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDVSAIRTD
GMA10096|LOC10050006 ---MGRVRTKTVKKSSRQVIERHYSRMTL-DFHTNKKLL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDVSAINTD
POP10019|RPS17       ---MGRVRTKTVKKSSRQVIERYYSKMTL-DFHTNKKIL--EEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPEESAIKIQ
CRE10019|RPS17       ---MGRVRTKTVKKASRVIIEKYYGRLTM-DFDTNKRVV--EEVALIATKRLRNKIAGFTTHLMKRIQRGPVRGISLKLQEEERERRMDFVPEESAINTL
VOL10020|RPS17       ---MGRVRTKTVKKASRVIIEKYYGRLTM-DFDTNKRVV--EEVALIATKRLRNKIAGFTTHLMKRIQRGPVRGISLKLQEEERERRMDFVPEESAINTL
HEM10017|rps17       ---MGRVKTKTVKKSARFLLEKYYSSLT-LDFQTNKKIC--DEVALIPSKGLRNKIAGYVTHLSKRIKKGPVRGISLKLQENEKDSKIEPKISELIKTTE
PTR10019|RPS17       ----MGVRTKTVKKSARTIVEKYYPRLTV-DFHTNKRII--DDVAILPSKRMRNKIAGYTTHLMRRIAKGPVRGISLKLQEEERERRLDFVPEVSALEQE
TPS10019|Rps17       ----MGVRTKTVKKSARTIVEKYYPRLTL-DFHTNKRII--DEIAITPSKRMRNKIAGFTTHLMKRIAKGPVRNISLKLQEEERERRLDFVPEVSALEQE
CYA10020|RPS17       ---MGRVRTKTVKKSARVIIEKYYSRLSANDFHTNKRVC--DEVAILPSKRMRNKVAGFITHLMKRIQRGPVRGISLKLQEEERERRMDFVPDVSAVNTE
DIC10019|RPS17       ---MGRVRTKTIKRASKLLIEKHYPRLT-NDFDTNKRTC--DKLAKIPSKRLRNKIAGFCTHLMRRIANGPVRGISYKLQEEEREKRDNYVPQESAIKTN
PLA10023|RPS17       ---MGRVRTKTIKRAARQIVEKYYAKLT-LDFQINKKIT--EEVAIIPSKRMKNKVAGFVTHLMKRIQKGPVRGISLKLQEEERERRLDFVPEKSQIDVS
TGO10019|RPS17       ---MGRVRTRTVKRAARQIVEKYYAKLT-LDFQINKKIS--EEVAVIPSKRMRNRVAGFVTHLMKRIQKGPVRGISLKLQEEERERRMDFVPERSEVDVA
GIA10019|Rps17       ---MGKVRTKTIKRAARKIVENNYESLKPKDFQNNKAICSKRNVAIIPSKRLRNKVAGYVTTLMNRVVKGPVHGISLRLQEEERERRDNYAPKKSEFDVE
HAL10037|VNG1433G    ----MAIKPDYVKKTGNILMERYQDAFSREDFEHNKDAV--TELTNIESKNVRNRIAGYITHKRN-----------------------------------
MET10018|MJ0245      --MMGRIRQTLIKRTAMELIKKYRDLFT-TDFETNKRVL--EEVAQISTKRLRNRIAGYITHKMRQLQ--------------------------------
PYR10041|PH1316a     ---MGKIRQGFIKRVARELFNKYPNEFTR-DFEHNKKKV--QELTNVTSKKIRNRIAGYITKLVRMKEEGKIL---------------------------
SUL10043|STS046      VIYVGNVYTKDIKRVAMQLYEKFKDQIS-TDYQANKKIV--DAYVDVMSKKVRNRIAGYLTRYAKMQRTQVKNEVEEEYIEGEG----------------


HUM10020|RPS17       ----QEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV---------------
DOG10019|Rps17       ----QEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGAV---------------
MUS10019|Rps17       ----QEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGAV---------------
RAT10019|Rps17       ----QEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGAV---------------
FUG10019|RPS17       ----QELIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFRTPRGV----------------
DAN10019|Rps17       ----QEIIEVDPDTKEMLKSFDFGNISSLQVTQPTVGMNFKTPRGV----------------
MED10019|Rps17       ----QELIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKQPRGV----------------
CIO10019|RPS17       ----QDIIEVDPTTKEMLKSLDFGNIPGLQLMQSGNNFNNQNRGNQGYQAR-----------
DRO10026|RpS17       ----QDIIEVDADTKEMLKLLDFHNIRGLQLTQPNTNNFGRRN-------------------
MOS10019|Rps17       ----QDIIEVDPETKEMLKHLDFNNIVVQLTNPTAPGYSNRRN-------------------
BEE10019|Rps17       ----HDIIEVDPETKEMLQMLGFNNIPGLQLTQSQLPPYSRRS-------------------
CEL10019|rps-17      Q---LTSIKVDTDTSDMLKAAGFNLPNVTVEDQGKNKGK-----------------------
BMA10019|RPS17       M---LTTIEVDTETKQMIESMELSIPMTDKTASTGMAGRR----------------------
STE10019|RPS17       ----QELIEVDPETKEMLKVLDFGGIPNLQVTQPITATQNFRPRQ-----------------
MBR10019|RPS17       ----EDGIVVDKETAEMLKALMPSLDVNVQAPGSNNRRR-----------------------
NEU10019|Rps17       QNSESGQLDVDTETKDLLKHLGFDS-IPVNVIPVTQAQPVER-GRRFGDRPRRD--------
GRI10019|Rps17       Q-SDSGQLDVDVETKDLLKHLGFDSTIPVNVIPVTQTQVSERSGRRFGDRPPRRD-------
GRA10020|Rps17       QNSESGQLDVDTETKDLLKHLGFES-IPVNVIPVTQQQIPER-GQRYGNRPRRD--------
STA10019|Rps17       QNSESGALDVDQETKDLLKSLGFDS-IPTNVIAVSQQQVVER-PRRFNDRPART--------
YAR10020|Rps17       H--TDNQLQVDNDTADLLKTLGFSS-LPLKVVHVSQQSAERRFRKRN---------------
POM10034|RPS17-1     R------VNVDQDTKDMLKSLGYDQ-IPVRVLAPAPQERFRRRQ------------------
POM10035|RPS17-2     K------INVDQDTKDMLKALGYDS-IPTVVVAASRPERPFRYRH-----------------
YST10031|RPS17A      R--SNGVLNVDNQTSDLVKSLGLK--LPLSVINVSAQ-RDRRYRKRV---------------
YST10032|RPS17B      R--SNGVLNVDNQTSDLVKSLGLK--LPLSVINVSAQ-RDRRYRKRN---------------
CIN10019|Rps17       T---TG-LEVDPDTKALLDSLNFDS-IPVNVVLPVSALPERGPRRDRRNVPGAGR-------
NEA10019|Rps17       E---ESPLEVDAETKDLLKSLGMDD-LSVNVINVSANAP---RERKTRFVPGAGRA------
MAY10019|Rps17       A---PGSLEVDPDTKDMLRSFGFDS-LPVTVTAPVTAY--QAPERRGRHVPGAGRR------
RHI10072|Rps17       A------IEVDPETKELLKAINFENLPGVQVTNPIAAQADARRGR-----------------
RHI10073|Rps17-2     A------IEVDPETKELLKAINFENLPGVQVTNPIAAQADVRRGRRDNRGPRAPRAQAEASA
RHI10074|Rps17-3     A------VEIDPETESLLKAINFENLPGVKVTAPVAAFTPRGRNTRPRKTAEAQA-------
ARA10054|RPS17A      E------IKVDKETLEMLASLGMSDTLGISAVDPQQAMAPIPAFGGGRAPRRY---------
ARA10055|At2g05220   E------IKVDKETLEMLASLGMSDTSGISAVEPQQAMAPIAAFGG-RAPRRY---------
ARA10056|RPS17C      D------VKVDKETLEMLASLGMSDIAGISQVETQQAMAPAVFGRPAGRYQR----------
ARA10057|RPS17D      E------IKVDKETLEMLASLGMSDTPGISAVEPQQAMAPIAAFGGGRAPRRY---------
RIC10063|RPS17A      E------IRVDKETMEMLAALGMADLPGVERQQEVSAPT---YSRPPYGGPRRDRV------
RIC10064|RPS17D      D------IRVDKETLDMLTSLGMADLPGVVRQPDASTSAPQQYGAARLPYARRDRA------
GMA10093|LOC10078540 Q------IEVDKETLDMLAALGMSEVPGVVQVDPVAVQAPLGFGRGAGRRY-----------
GMA10094|LOC10052703 H------IEVDKETLDMLHSLGINDIPGITQVDPVPVQQAFPFTRRY---------------
GMA10095|LOC10081906 Q------IEVDKETLDMLAALGMSEVPGIVQVDPVAVQAPLGFGRGGPGRRY----------
GMA10096|LOC10050006 H------IEVDKETLDMLHSLGINDIPGITQVDPVPVQQNFPFTRRY---------------
POP10019|RPS17       E------IKVDKETIDMLAALGMSDFPGIVEVEPQ-PMVPTQGFGRGGGARRY---------
CRE10019|RPS17       S------IEVDKDTMDMLKSINMGTLSGVQLAQPQTNFKPYGGNRGGNKQQ-----------
VOL10020|RPS17       A------IEVDKDTMDMLKSINMGTLSGVQLAQPQTGFKPYGGGNRGKQ-------------
HEM10017|rps17       T------IEVDIETKSLIFSLFENSPETLKMFK-----------------------------
PTR10019|RPS17       T------IQIDPDTRDLLESLGYGKLNGVAVNQAHTRD------------------------
TPS10019|Rps17       T------IAIDRETRDLLESMGYGSLNGVVVSNSADRS------------------------
CYA10020|RPS17       T------IEVDPDTKAMLRSIGLGSMSGVVVIQPGERRPYHTRK------------------
DIC10019|RPS17       E------VKIDRDVEEMLKSTLEFPTIPQIHVVDQKRYNKNTKKSNK---------------
PLA10023|RPS17       V------IYVEPDTLRMIKSLGINISNMKVHNPMINTNQQKQNRMNNQF-------------
TGO10019|RPS17       T------ITVDQDTADMLRALDINLPNVVVPSAGRPSNNQNRRN------------------
GIA10019|Rps17       N------ITVSGATQQMIDSIGFKCMSTSLKVIDPTMRKRARDTRE----------------
HAL10037|VNG1433G    --------------------------------------------------------------
MET10018|MJ0245      --------------------------------------------------------------
PYR10041|PH1316a     --------------------------------------------------------------
SUL10043|STS046      --------------------------------------------------------------