CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10014|VNG1700G    -----------MAIGLN-VTEPEGTCSDEDCPFHGNLSVRGQVLEGEVASTDMEKTVVVEREYDVFVPKYDRYMKRRSRVPAHAPECFDISVGDTVSIAE
MET10019|MJ0465      --------MAARNIGIQ-VKAPEVECDDKNCPFHGNLPVRGQSFVGVVVSDKPHKTVIIKREVVKYIKKYERYERRTTKLAAHNPPCIHARVGDIVRVME
PYR10013|PH1770      ------VEKMVRDIGLR-IQPPAEKCDDPKCPWHGHLKIHGRVFEGIVISDKPRKTVTVERQYYHYLKKYERYELRRSRIHAHNPPCINAKVGDRVLIAE
THE10017|TTHA1683    --------------------------------------MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHD-PEEKYKLGDVVEIIE
SYN10018|ssl3437     --------------------------------------MAIKERVGIVVSNKMDKTVVVAVESRSPHPKYGKIVVKTKKFKAHD-EENQCQEGDKVRIQE
BAC10017|Bsu0125     ----------------------------------MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKKFKAHD-ENNQAKIGDIVKIME
ECO10017|rpsQ        ------------------------------------MTDKIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHD-ENNECGIGDVVEIRE
SUL10014|ST0423      VVIMGKKGALVKNIGIEGVNPPSKTCDDINCPFHGNLRVRGIILEGRLIRYRAEKTGVVERDYLFYDTKYKRYERRRSRIHVHIPPCLDVKEGDNVIIAE


HAL10014|VNG1700G    TRPLSKTKSHVVVEITDGGDA-----------------------
MET10019|MJ0465      CRPISKTKAFVVVEKLGRIDEVKGEE------------------
PYR10013|PH1770      TRPLSKTKHFVVVAVLERAEERR---------------------
THE10017|TTHA1683    SRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
SYN10018|ssl3437     TRPLSKTKRWQVINIMSHSS------------------------
BAC10017|Bsu0125     TRPLSATKRFRLVEVVEEAVII----------------------
ECO10017|rpsQ        CRPLSKTKSWTLVRVVEKAVL-----------------------
SUL10014|ST0423      CRPIAKSVSFVVIGKR----------------------------