CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10021|RPS18       ---MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQ
DOG10020|Rps18       ---MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQ
MUS10020|Rps18       ---MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQ
RAT10020|Rps18       ---MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQ
FUG10020|RPS18       ---MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELTEEEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQ
DAN10020|Rps18       ---MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQ
MED10020|Rps18       ---MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEEEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQ
CIO10020|RPS18       ---MSLVIPEKFQHILRILNTNIDGRRHIAFALTAIKGIGRRFSTLVCKKADVDLTKRAGELSDDEIDRIVTIMQNPRQYKIPDWFLNRQKDVRDGKFGQ
DRO10027|RpS18       ---MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVDKVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQ
MOS10020|Rps18       ---MSLVIPEKFQHILRVLSTNIDGKRTVPIALTAIKGVGRRYAHVVLKKADVDPFKRAGECSDEEVEKIITIISNPRHYKIPDWFLNRQKDIVDGKYMQ
BEE10020|Rps18       ---MSLVIPEKFQHILRVMGTNIDGNRKVMFAMTAIKGVGRRYANIVLKKADIDLDKRAGECSEEEVEKIVTIMANPRQYKIPDWFLNRQKDIVDGKYSQ
CEL10020|rps-18      ---MSLIIPEKFQHIHRVMNTNIDGNRKVPYALTAIKGVGRRFAFVCCRKADVDVNKRAGELTEEDFDKIVTIMQNPSQYKIPNWFLNRQKDIKDGKTGQ
BMA10020|RPS18       ---MSLIIPEKFQHIHRVMNTNIDGNRKVPFALTAIKGVGRRFAFVVCRKADIDINRRAGELSEEDLEKLQQVMQNPSQYKIPNWFLNRQKDIKDGKYSQ
STE10020|RPS18       ---MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIKGVGRRYANIVCKKADIDMNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDHKDGKYSQ
MBR10020|RPS18       ---MSMVMPENFQHILRVMNTNIAGDRNIMYAMTAIKGVGRRYSNLCLKKAEISTRRRAGELTEDDVRRVVTIMQNPRQYKIPDWFLNRKKDIKDGTYSQ
NEU10020|Rps18       -MSLVSGEKSNFNHILRLLNTNVDGKQKVVYSLTKIKGVGRRYSNLVCKKADVDLSKRAGELTSEELERIVTIMQNPTAYKIPAWFLNRQRDIVDGKDSQ
GRI10020|Rps18       -MSLVSGEKSNFQFILRLLNTNVDGKQKIVYALTKIKGVGRRYSNLVVKKADVDLNKRAGELTSEELERVVTILQNPTQYKIPSWFLNRQRDIVDGKDSQ
GRA10021|Rps18       -MSLVSGEKSNFQFILRLLNTNVDGKQKVMYALTKIKGVGRRYSNLVCKKADVDLNKRAGELTSEELERIVTILQNPTQYKIPTWFINRQRDIVDGKDSH
STA10020|Rps18       -MSLVSGEKSNFQYIIRLLNTNVDGKQKVMYALTKIKGVGRRYSNLVCKKADVDLGKRAGDLTSEELERIVTIIQNPLQYKIPSWFLNRQRDIVDGKNSQ
YAR10021|Rps18       -MSLVVTEQGNFQHILRLLNTNVDGRIKVMYAMCKIKGVGRRYANLVCKKADVDLSKRAGELTVEELERIVTIIQNPGQYKIPGWFLNRQRDFTDGKDSQ
POM10036|RPS18-1     ---MSLVVPDNFQHILRLLNTNVDGKVKVMFAMTQIKGVGRRYANIVCKKADIDMSKRAGELTTEELERIVTIIQNPSQFKIPSWFLNRQKDINDGKSFQ
POM10037|RPS18-2     ---MSLVVPDNFQHILRLLNTNVDGKVKVMFAMTQIKGVGRRYANIVCKKADIDMSKRAGELTTEELERIVTIIQNPSQFKIPSWFLNRQKDINDGKSFQ
YST10033|RPS18A      -MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYH
YST10034|RPS18B      -MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYH
CIN10020|Rps18       MSLVVPEAHQQFQHILRLLNTNVDGKRKIMYALTEIKGVGRRYANLVCKKADVDLNKRAGELNSDELERIVTIIQNPTQFKIPTWFLNRQKDIVDGKNYQ
NEA10020|Rps18       MSFAPLEAHQQFQHILRLLNTNVKGGGKIMYALTEIKGVGRRYANLVCKKADVDLNKRAGELNSDELERIVTIMQNPAQFKIPSWFLNRQRDINDGKSQH
MAY10020|Rps18       MSLVPPDPSQNFAFILRLLNTNVDGKIKVQYALTQIKGVGRRYANIVCKKADIDLSKRAGELNSDELERIVTILQNPAEFKIPSWFLNRQRDIVDGKSSQ
RHI10075|Rps18       -MSLVVPERTTFQHILRLLNTNVDGRVKIQIALTSVKGVGRRFANIACKKADIDLTKRAGELSSEELERIVTILQNPAQYKIPNWFLNRQKDIVDGKSSQ
RHI10076|Rps18-2     -MSLVVPERTTFQHILRLLNTNVDGRVKIQIALTSVKGVGRRFANIACKKADIDLTKRAGELSSEELERIVTILQTPAQYKIPNWFLNRQKDIVDGKSSQ
RHI10077|Rps18-3     -MSLVVPERTTFQHILRLLNTNVDGRVKIQIALTSVKGVGRRFANIACKKADIDLTKRAGELSSEELERIVTILQNPAQYKIPNWFLNRQKDIVDGKSSQ
RHI10078|Rps18-4     -MSLVVPERTTFQHILRLLNTNVDGRVKIQIALTSVKGVGRRFANIACKKADIDLTKRAGELSSEELERIVTILQNPAQYKIPNWFLNRQKDIVDGKSSQ
ARA10058|RPS18A      ---MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQ
ARA10059|RPS18B      ---MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQ
ARA10060|RPS18C      ---MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQ
RIC10065|RPS18A      ---MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIACKKADIDMNKRAGELTPEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQ
RIC10066|RPS18A      ---MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIACKKADIDMNKRAGELTPEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQ
RIC10067|RPS18B      -------MGEDFQHILRLLNTNVDGKQKIMFALTSIKGIGRRFSNIACKKADIDMNKRAGELTPEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQ
GMA10097|LOC10050008 ---MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADVDMNKRAGELSAAELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQ
GMA10098|LOC10030647 ---MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFSNICCKKADVDMNKRAGELSAAELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQ
GMA10099|LOC10030664 ---MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADVDMNKRAGELTAAELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQ
GMA10100|LOC10079122 ---MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADVDMNKRAGELSAIELDSVMTVVANPRQFKIPDWFLNRKKDYKDGKYSQ
POP10020|RPS18       ---MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFSNIVCKKADVDMNKRAGELSAAELDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQ
CRE10020|RPS18       --MGSLVQGDDFQHILRLLNTNVDGKNKIMYAMTAIRGIGRRFSNLVCKKAEVDLRKRAGECSADELERMMGIVANPRAYKIPDWFLNRQKDHKTGRFSQ
VOL10021|RPS18       --MGSLVQGDDFQHILRLLNTNVDGKNKIMYAMTAIKGIGRRFSNLVCKKAEVDLRKRAGECSADELERMMGIVANPRAYKIPDWFLNRQKDHKTGRYSQ
PTR10020|RPS18       -MSSSLMQGPEFQHILRILNTNVEGKRNVVFGLTKIPGIGRRFSDLICKKAEVDVDKRAGELTADEIEKVVAVIQNPRQFKIPLWFLNRQKDFKTGKYSQ
TPS10020|Rps18       ---MSMMQGPEFQHILRILNTNVEGKRNVVFGLTKIKGLGRRFADLICKKAEIDVNKRAGELTADEIEKLVAIIQNPRQFKIPLWFLNRQKDFKTGKYSQ
CYA10021|RPS18       --MAIVLNEGEFRYILRILNTNIDGKQKVAYALTAIKGIGRRFADLVCKKAEVDLGKRAGQLTDEEVDRIVTIIQNPRQFKIPDWFLNRRKDIRDGKYQQ
DIC10020|RPS18       -MSSSLVFQGEFQHIIRIYNTNVDGRRKIQYALTCVKGVGRRFANLVCKKADIDTSKRAGELSKDEVERLTTIMNHPRQYNIPTWFLNRQKDIKDGKYSH
PLA10024|RPS18       -MSLQVIDNNDFQHILRILNTNVDGKEKVIIALTAIKGIGKRMATVICKQANVDPTKRAGELTTEEIDNIVHIMSTPTQFKIPDWFLNRRKDLKEGKNIH
TGO10020|RPS18       -MSIQVSNNQDFQHILRILNTNVDGREKVVVALTAIRGIGRRVSNLICKKADIDTNKRAGELTADEISKVVAIASTPQQFKIPTWFLNRQKDVKDGKHKH
GIA10020|Rps18       --MTTIVQPNDYRDLLRMFNTNIQGKVVLECALVGIKGIGRRFANVALKKANIDVHKRAGELTAAEEDALMKVLEDPLSHGIPAWMLNRNNDFESGKDMH


HUM10021|RPS18       VLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK--
DOG10020|Rps18       VLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK--
MUS10020|Rps18       VLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK--
RAT10020|Rps18       VLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK--
FUG10020|RPS18       VLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK--
DAN10020|Rps18       VLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK--
MED10020|Rps18       VLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK--
CIO10020|RPS18       ILSNQLDNKLREDIERLKKIRAHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK--
DRO10027|RpS18       LTSSNLDSKLRDDLERLKKIRSHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK--
MOS10020|Rps18       LTSSNIDSKLREDLERLKRIHAHRGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK--
BEE10020|Rps18       LTSSYLDSKLREDLERMKKIRAHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKK--
CEL10020|rps-18      LLSTAVDNKLREDLERMKKIRLHRGLRHYWGLRVRGQHTKTTGRKGRTVGVSKKKGG
BMA10020|RPS18       MLSTSLDNKLREDLERLKKIRLHRGLRHYWGLRVRGQHTKTTGRKGRTVGVSKKKGG
STE10020|RPS18       ILANGLDNKMREDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGRKGRTVGVAKKKS-
MBR10020|RPS18       LLASDLNVKLRDDLERMKKIRLHRGIRHYWGVRVRGQHTKTTGRRGRTVGVSKKKGG
NEU10020|Rps18       ILANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGN
GRI10020|Rps18       TLANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG
GRA10021|Rps18       ILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG
STA10020|Rps18       TLANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQHSKTTGRRGRTVGVSKKKG-
YAR10021|Rps18       LLVNQLDVKLRDDIERLKKIRAHRGLRHYWGYKVRGQHTKTTTRKGKIMAHRG----
POM10036|RPS18-1     LLANNVDSKLREDLERLKKIQTHRGLRHALDLRVRGQHTKTTGRRGKTVGVSKKK--
POM10037|RPS18-2     LLANNVDSKLREDLERLKKIQTHRGLRHALDLRVRGQHTKTTGRRGKTVGVSKKK--
YST10033|RPS18A      TLANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA----------
YST10034|RPS18B      TLANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA----------
CIN10020|Rps18       ILSNGVDSKLRDDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGKTVGVSKKRG-
NEA10020|Rps18       ILSNVIDQRLREDLERLKKIRTHRGLRHHWGLKVRGQHTKTTGRRVGRAVAGKKK--
MAY10020|Rps18       LLSNNIDSKLRDDLERLKKIKAHRGIRHYLGLRVRGQHTKTTGRRG-RTVANKKK--
RHI10075|Rps18       VISNVLDTKYREDLERLKKIRAHRGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK--
RHI10076|Rps18-2     VISNVLDTKYREDLERLKKIRAHRGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK--
RHI10077|Rps18-3     VISNVLDTKYREDLERLKKIRAHRGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK--
RHI10078|Rps18-4     VISNVLDTKYREDLERLKKIRAHRGLRHYWGVRVRGQHTKTTGRRGRTVGVSKKK--
ARA10058|RPS18A      VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
ARA10059|RPS18B      VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
ARA10060|RPS18C      VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
RIC10065|RPS18A      VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
RIC10066|RPS18A      VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
RIC10067|RPS18B      VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
GMA10097|LOC10050008 VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
GMA10098|LOC10030647 VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
GMA10099|LOC10030664 VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
GMA10100|LOC10079122 VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
POP10020|RPS18       VVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR--
CRE10020|RPS18       LTSSQLDTVMRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRAGKTVGVAKKK--
VOL10021|RPS18       LTSSGLDTALRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRAGKTVGVAKKK--
PTR10020|RPS18       VFAQNIAAKLRDDIERLKKIRAHRGLRHWWNIRVRGQHTCSTGRRRT----------
TPS10020|Rps18       VFAQNFDAKLRDDIERMKKIRAHRGLRHWWGIRVRGQHTCSTGRRKH----------
CYA10021|RPS18       LVSNNLDFKLREDLDRMRKVRLHRGLRHFWGIRVRGQKTKTTGRHGKTVGVSKTRA-
DIC10020|RPS18       CLANQIDVKFREDLERLKKIRAHRGVRHHFGLRVRGQKTKTTGRRGRTVGVAGRR--
PLA10024|RPS18       VIANQLDSYLREDLERMKKIRLHRGLRHHWGLRVRGQHTKTTGRRGRTVGVAKKKGA
TGO10020|RPS18       VVANGLDTVWREDLERLKKMRLHRGLRHYWGLKVRGQHTKTTGRHGRTVGVAKKKGC
GIA10020|Rps18       ILVNTIASTHRADLERLRKTRCERGVRHHHNLKVRGQHTKSTGRRGHVVGVQRKKK-