CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10015|VNG1693G    ---------MSTEYRTGREGEFTYRGHDLDELQEMSLEDVAELLPARQRRTITRGLSEEHHKVLAEARESG---TEETANNPIRTHLRDMPVLPEFVGLT
MET10021|MJ0180      MASARRRRIKKKKQVISKKIEFRYRGYTLEELQQMPLREFAKLLPARQRRTLLRGLTPQQKKLAMKIKKARRLLNKGKEPRIIRTHCRDFVITPDMVGLT
PYR10014|PH1774      ----------------MARKEFRYRGYTLEQLMNMSLEELARLLPARQRRSLRRGLTPEQKKLLRKIRLAK----KGKYNKPIRTHCRDMIILPEMVGLT
THE10019|TTHA1688    -----------------------------------------------MPRSLKKGVFVDDH-LLEKVLELN----AKGEKRLIKTWSRRSTIVPEMVGHT
SYN10020|ssl3432     -----------------------------------------------MGRSLKKGPFVAAS-LLRKIDKLN----DKGDKQVVKTWSRASTILPQMVGHT
BAC10019|Bsu0120     -----------------------------------------------MARSLKKGPFVDGH-LMTKIEKLN----ETDKKQVVKTWSRRSTIFPQFIGHT
ECO10019|rpsS        -----------------------------------------------MPRSLKKGPFIDLH-LLKKVEKAV----ESGDKKPLRTWSRRSTIFPNMIGLT
SUL10015|ST0426      ----------MSLEIPPEWKKFRYRGKSLDELLNMPMDEFIKLLPSRQRRSLKKGFSDKQRRLLEKIRKYVR---EGKYSKTIKTHVRDMIILPEMVGLK


HAL10015|VNG1693G    FAVYTGQEFERVEVQPEMIGHYLGEFQLTRSSVEHGQAGIGATRSSKFVPLK-
MET10021|MJ0180      FGVYNGKEFVEVKVTPEMIGHYLGEFSLTRKPVQHGAPGMGATRSSMFVPIK-
PYR10014|PH1774      IYVHNGKEFVPVEIKPEMIGHYLGEFAPTRKRVQHGAPGIGATRSSMFVAVK-
THE10019|TTHA1688    IAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK--------
SYN10020|ssl3432     IAVHNGRQHVPVFVSEQMVGHKLGEFAPTRTFRSHSKSDKKARK---------
BAC10019|Bsu0120     IAVYDGRKHVPVFISEDMVGHKLGEFAPTRTYKGHASDDKKTRR---------
ECO10019|rpsS        IAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK---------
SUL10015|ST0426      FAVYNGKEFVEFQVVPEMIGHYLGEFSITTKKVEHGEPGLKATRSSLFLAMKG