CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10002|RPS2        MADDAGAAGGPGGPGGPGMGNRGGFRGGFGSGIRGRGRGRGR----GRGRGRGARGGKAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDF
DOG10002|Rps2        MADDAGAAGGPGGPGGPGMGGRGGFRGGFGSGIRGRGRGRGR----GRGRGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDF
MUS10002|Rps2        MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGR----GRGRGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDF
RAT10002|Rps2        MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGR----GRGRGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDF
CHK10002|Rps2        MADDAGAAGGAG-------AARGGFRGGFGTGLRGRGRGRGR----GRGRGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDF
FUG10002|RPS2        --------------MADDAGGRGGFRGGFGAGGRGRGRGRGR----GRGRGRGARGGKSEDKEWVPVTKLGRLVKDMKIKTLEEIYLYSLPIKESEIIDF
DAN10002|Rps2        --------------MADDAGGRGGFRGGFGTGGRGRGRGRGR----GRGRGRGARGGKSEDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDF
MED10002|Rps2        --------------MADDAGGRGGFRGGFGAGGRGRGRGRGR----GRGRGRGARGGKSEDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDF
CIO10002|RPS2        ------------MADAAAPAGGSGTRGGFRGGFGGRGRGRGR----GRGRGRGRGRGKEDEKSWVPVTKLGRLVKDGMIKSLEEIYLFSLPIKEFGIIDD
DRO10002|sop         --------------MADEAPARSGFRGGFGSRG-----GRGGRGRGRGRWARGRG--KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDF
MOS10002|Rps2        --------------MADAAPARGGFRGGFGSRGGARGGGRGGRGRGRGRGRGRGG--KEDSKEWVPVTKLGRLVKDGKIRTLEEIYLYSLPIKEFEIIDF
BEE10002|Rps2        -------------MADTAPAARGGFRGGFGSRGGGDRGGPRGRGRGGRGRGRGRGRGKEDSKEWIPVTKLGRLVRDGKIESLEHIYLFSLPIKEYEIIDK
CEL10002|rps-2       -------MADRGGFQSGFGGRGGGRGGARPAGDRPAGRGGRGGRGGRGGRGGRAGRGGEKETEWTPVTKLGRLVKEKKITTLEEIYLNSLPIKEFEIIDA
BMA10002|RPS2        -------MAERGGFRGGFGSGERSGRGGRGGGERSRGRG--RGRGGRGGRGGKEG-----DKEWVPVTKLGRLVKDRKITSLEEIYLNSLPIKEYEIIDM
STE10002|RPS2        ----------------MADAEPAGGRGGFRGGFGGRGRGRGR----GRGRGRGRGRGKAEDKEWVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDF
MBR10002|RPS2        -------------------------MAEAAPAGDSRGRGRGR----GRGRGRGRGGADGGKETWVPVTKLGRLVKDGKIKSLEHIYLHSLPIKEYQIIDH
NEU10002|Rps2        ----------------MADRGTSGPRGGGFASRGDRGGDRGRGRGG---RGRGRRGGKSEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPIKEYQIVDF
GRI10002|Rps2        -------------MADAAPRGGGFASRGGDRGGDRGRGDRGRGRG----RGRGRRGGKSDEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPIKEYQIVDF
GRA10002|Rps2        ----------------MADRGTS--RGGGFASR---GGDRGRGRG----RGRGRGRGKNEEKEWQPVTKLGRLVKAGKINSMEEIYLHSLPIKEYQIVDN
STA10002|Rps2        -----------------MADAGAPRGGGGFGSRGDRGGDRGRGRG----RGRGRRGGKSEEKEWQPVTKLGRLVKAGKIKSMEEIYLHSLPVKEYQIVDF
YAR10002|Rps2        --------------------MSTEAAAPRGGFGRGRGDRGGRGRG----RGGRGRGRKDEEKGWVPVTKLGRLVKAGHIKSMEEIYLHALPIKEYQIVDQ
POM10003|RPS2        -------------------------MAESAPRGFGRGGRGGRGRG-----RGRRGAKRDEEKEWVPVTKLGRLVKAGKIKSIEEIYLYSLPIKEYQIVDY
YST10003|RPS2        -------------------------MSAPEAQQQKRGGFGGRNRG----RPNRRGPRNTEEKGWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDT
CIN10002|Rps2        ---------------------MADSARGRGGFGRGRGER-GRGRR----GPRRGGRRDEEKD-WVPVTKLGRLVKDGKIKSMEEIYLFSLPVKEYQIIDF
NEA10002|Rps2        -------------------------MAERGGFGRGRGGAGGRGRR----GPRRGGKKEEDKE-WVPVTKLGRLVKDGKIKSMEEIYLFSLPVKEFQIIDL
MAY10002|Rps2        --------------------MADAAPRGRGGFGRDRG---GRGRR----GPRRGGRRDGEKEEWVPVTSVGRLVKDGKIKSIEEIYLFSLPIKEYQIIDL
RHI10006|Rps2        ----------------------MADSATAGASRGRGGFGRGRGRG----GRAGRGRRGEEKNEWVPVTKLGRLVKANKIKSIEEIYLFSLPIKEYQIVDY
RHI10007|Rps2-2      ----------------------MADSATAGN-RGRGGFGRGRGRG----GRAGRGRRGEEKNEWVPVTKLGRLVKANKIKSIEEIYLFSLPIKEYQIVDY
RHI10008|Rps2-3      ----------------------MADSATAGN-RGRGGFGRGRGRG----GRAGRGRRGEEKNEWVPVTKLGRLVKANKIKSIEEIYLFSLPIKEYQIVDY
RHI10009|Rps2-4      ----------------------MADSATAGASRGRGGFGRGRGRG----GRAGRGRRGEEKNEWVPVTKLGRLVKANKIKSIEEIYLFSLPIKEYQIVDY
ARA10003|RPS2A       ---------MAERGGEGGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRG--RRGGRASEETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDH
ARA10004|RPS2B       ---------MAERGGESGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRG--RRGGRASEETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDH
ARA10005|RPS2C       ---------MAERGGERGVERGGERGDFGRGFGGRGGRGDRGGRGRGGRGG-RRGGRASEEEKWVPVTKLGRLVAAGHIKQIEQIYLHSLPVKEYQIIDM
ARA10006|RPS2D       -------------MAERGVERGGDRGDFGRGFGGRGGG----RGGPRGRG--RRAGRAPEEEKWVPVTKLGRLVKEGKITKIEQIYLHSLPVKEYQIIDL
RIC10004|RPS2A       ---------------MAERGGGGERGGERGGFGRGFGRGGRGDRGRGGRGGRRGP--RQEEEKWVPVTKLGRLVKENKIHKIEEIYLHSLPVKEHQIVEQ
RIC10005|RPS2B       -----------------MAERGGERGGERGGFGRGFGRGGRGDRG-GRRGGRRGP--RQEEEKWVPVTKLGRLVKEGRFSKIEEIYLHSLPVKEHQIVET
GMA10005|LOC10079710 ----------------MAERGGGD----RAGFG--RGFGGRGRGGDRGRGRRRAGGRRDEEEKWVPVTKLGRLVKEGKIRSLEQIYLHSLPIKEHQIIDT
GMA10006|LOC10081036 ----------------MAERGGGDRGGDRGGFG--RGFGGRGRGGDRGRGRRRGP-RREEEEKWVPVTKLGRLVKEGRIRSLEQIYLHSLPIKEHQIIDT
GMA10007|LOC10082035 ----------------MAERGGGDRGSDRGGFG--RGFGGRGRGGDRGRGRRRGP-RREEEEKWVPVTKLGRLVKEGRIRSLEQIYLHSLPIKEHQIIDT
POP10002|RPS2        ----------------MEERPPAERGSFGRGFGGRGDRGGRGGRGDRGGRGRRRSGRKEEEEKWVPVTKLGRLVKDGKISSVEQIYLHSLPIKEYQIIDT
CRE10002|RPS2        -----------------MADRGGERAERGERGSFGRGFGGRGDRG-RGRGARRARGKKEDEEKWVPCTKLGRLVQQGKIKSLEQIYLFSMPVKEYQIVEY
VOL10002|RPS2        -----------------MADRGGE------RGSFGRGFGGRGDRG-RGRGARRARGKKEDEEKWVPCTKLGRLVQQGKIKSLEQIYLFSMPVKEYQIVEY
HEM10002|rps2        -----------------------------MEEKKSNHNAQPTDLKRKNYKKNKSYKNKPESQEWYPITKLGRLVKKNKIKSLEEIFYFSLPIKEQEIVDF
PTR10002|RPS2        -------------------MSEGEAGRGRGGFGRDGGRGRGGGRGRGRGRGGGRGRGDREENVWVPVTKLGRLVKEGKIGSMEEIFLFSLPVKEAEIIDF
TPS10002|Rps2        -------------------MSEERGGFGRGRGERGRGRGRGD-RGRGRGRGRGR-EGGRDENVWVPVTKLGRLVKEGKIGSIEEIFLFSIPVKEAEIIDY
CYA10002|RPS2        ----------MAERGGFPGGFGESRGGGRSARGGRGGRGGRGGRGGRGGARAAGRDGTAAHEEWIPTTKLGRLVKDGKIPSLEHIYLFSLPIKEPGIIDY
DIC10002|RPS2        ---------------MADTTTAAQADQKPTRAFGAGRPQRGAGGAPQRGGPRPQRGGQGETKSWTPVTKLGRLVALGLVENIHEIYLFSLPIKEYQIIDK
PLA10002|RPS2        -----------------------MEDRGGFSRGFGRGVRGTRGRGGRGARGRGRGSAEDDLKNWVPVTKLGRLVKEGKIVSIEEIYLHSLPIKEYQIIDY
TGO10002|RPS2        -----------------------MAERGSFGRGFGRGGGRGRGRG----RGRGRGGAEDDLKDWVPITKLGRLVRDGKISSIEEIYLFSLPIKEYQIIDH
GIA10002|Rps2        -------------------------------------MQAESAPRPERPERGERGPRQMEEEEWHPSTKLGRLVKAGKIESLYDIFKYSLPIKETEIIDY


HUM10002|RPS2        FLGAS-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSV
DOG10002|Rps2        FLGAS-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSV
MUS10002|Rps2        FLGAS-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSV
RAT10002|Rps2        FLGAS-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSV
CHK10002|Rps2        FLGSS-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSV
FUG10002|RPS2        FLGSG-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSV
DAN10002|Rps2        FLGSA-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIIPVRRGYWGNKIGKPHTVPCKVTGRCGSV
MED10002|Rps2        FLGSG-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSV
CIO10002|RPS2        LIGSS-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAVGDSNGHVGLGVKCSKEVATAIRGAITLAKLSIIPIRRGYWGNKIGKPHTVPCKVHGKCGSV
DRO10002|sop         FLGSS-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSV
MOS10002|Rps2        FLNRL-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGRPHTVPCKVSGKCGSV
BEE10002|Rps2        FLGVE-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYKGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGDPHTVPCKVTGKCGSV
CEL10002|rps-2       LCSN------LKDEVLKISPVQKQTTAGQRTRFKAFVAIGDHAGHVGLGVKCSKEVATAIRGAIVAAKLAVVPVRRGYWGNKIGLPHTVPCKVTGKCASV
BMA10002|RPS2        LLSN------LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDHNGHVGLGVKCSKEVATAIRGAIIAAKLSVIPVRRGYWGNKIGQPHTVPCKVTGKCGSV
STE10002|RPS2        FLGAA-----LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGST
MBR10002|RPS2        FLPE------LKDEVLKIMPVQKQTTAGQRTRFKAFVAIGDGNGHLGLGVKCSKEVATAIRGAMIQAKLAVIPVRRGYWGNKIGAPHTVPCKVTGRCGSV
NEU10002|Rps2        FLP------KLKDEVMKIKPVQKQTRAGQRTRFKAIVIIGDSEGHVGLGIKTSKEVATAIRAAIIIAKLSVIPVRRGYWGANLGLPHSLPVKESGKCGSV
GRI10002|Rps2        FLP------KLKDEVMKIKPVQKQTRAGQRTRFKAIVIIGDSEGHVGLGIKTSKEVATAIRAAIIIAKLSVIPVRRGYWGTNLGTPHSLPVKESGKCGSV
GRA10002|Rps2        FLP------KLKDEVMKIKPVQKQTRAGQRTRFKAIVIIGDSEGHVGLGIKTSKEVATAIRAAIIIAKLSVIPVRRGYWGTNLGAVHSLPTKESGKCGSV
STA10002|Rps2        FLP------KLKDEVMKIKPVQKQTRAGQRTRFKAIVVIGDSEGHIGLGIKTSKEVATAIRAAIIIAKLSVVPIRRGYWGTNLGEPHSLPTKESGKCGSV
YAR10002|Rps2        LLP------VLEDEVMKIKPVQKQTRAGQRTRFKAVVVIGDSNGHVGLGIKTAKEVATAIRAAIIIAKLAIIPVRRGYWGSSLGEPHTVPTKTSGKCGSV
POM10003|RPS2        FLP------RLNDEVMKVVPVQKQTRAGQRTRFKAFVVIGDSDGHVGLGIKCAKEVATAIRGAIIMGKLSIMPIRRGYWGTALGDPHTVPVKVSGKCGSV
YST10003|RPS2        LLP------GLQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGKCGSV
CIN10002|Rps2        FLP------KLKDEVMKIMPVQKQTRAGQRTRFKAFVAIGDFDGHVGLGVKCAKEVATAIRGAIILAKLSVIPVRRGYWGAALGQPHTVPSKVSGKVGSV
NEA10002|Rps2        FLP------ALKDEVMKIMPVQKQTSAGQRTRFKAFVAVGDFDGHVGLGIKCAKEVATAIRGAIISAKLSIVPVRRGYWGSHIAEPHTVPCKVSGKSGSV
MAY10002|Rps2        LLP------KLKDEVMKIMPVQKQTRAGQRTRFKAFVAVGDSDGHLGLGVKCAKEVATAIRGAIIVAKLSTIPVRRGYWGNALGEPHTVPMKVSGKTASV
RHI10006|Rps2        FLP------KLTDQVMKIMPVQKQTTAGQRTRFKAFVVIGDENGHVGLGVKCAKEVATAIRGGIILAKLAIIPVRRGYWGSNLGEPHTVPCKVSGRCGSV
RHI10007|Rps2-2      FLP------KLTDQVMKIMPVQKQTTAGQRTRFKAFVVIGDENGHVGLGVKCAKEVATAIRGGIILAKLAIIPVRRGYWGSNLGEPHTVPCKVSGRCGSV
RHI10008|Rps2-3      FLP------KLTDQVMKIMPVQKQTTAGQRTRFKAFVVIGDENGHVGLGVKCAKEVATAIRGGIILAKLAIIPVRRGYWGSNLGEPHTVPCKVSGRCGSV
RHI10009|Rps2-4      FLP------KLTDQVMKIMPVQKQTTAGQRTRFKAFVVIGDENGHVGLGVKCAKEVATAIRGGIILAKLAIIPVRRGYWGSNLGEPHTVPCKVSGRCGSV
ARA10003|RPS2A       LVGP-----TLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSV
ARA10004|RPS2B       LVGP-----TLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSV
ARA10005|RPS2C       LIGP-----TLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSV
ARA10006|RPS2D       LVGP-----SLKDEVMKIMPVQKQTRAGQRTRFKAFIVVGDSNGHVGLGVKCSKEVATAIRGAIILAKLSVVPIRRGYWGNKIGKPHTVPCKVTGKCGSV
RIC10004|RPS2A       LVP------GLKDEVMKITPVQKQTRAGQRTRFKAFVVVGDGDGHVGLGVKCAKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSV
RIC10005|RPS2B       LVP------GLKDEVMKITPVQKQTRAGQRTRFKAFVVVGDNNGHVGLGVKCAKEVATAIRGAIILAKLSVVPVRRGYWGNKIGQPHTVPCKVTGKCGSV
GMA10005|LOC10079710 LVGP-----TLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDNNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGSV
GMA10006|LOC10081036 LVGP-----TLKDEVMKITPVQKQTRAGQRTRFKAFVVVGDNNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGSV
GMA10007|LOC10082035 LVGP-----TLKDEVMKITPVQKQTRAGQRTRFKAFVVVGDNNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGSV
POP10002|RPS2        LIGP-----ILKDEVMKITPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCAKEVATAIRGAIILAKLSIIPVRRGYWGNKIGKPHTVPCKVTGKCGSV
CRE10002|RPS2        FLGS-----ALKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDFNGHIGLGVKCAKEVATAIRGAIIQAKMSVVPVRRGYWGNKIGKVHTVPTKVTGKCGSV
VOL10002|RPS2        FLGS-----ALKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDHNGHIGLGVKCAKEVATAIRGAIIQAKMSVVPVRRGYWGNKIGKVHTVPTKVTGKCGSV
HEM10002|rps2        FLKEK-----LKDEVLKIMPVQKQTRAGQRTRFKAFLIVGDFSGHVGLGIKTAKEVANAIKGALVIAKLTIIPSLKGFWGEKIGKSHTVPMKVTGKCGSI
PTR10002|RPS2        FLKDK-----LQDEVMKIMPVQKQSSAGQRTRFKAFVAVGDGAGHIGLGVKCSSEVANAIRGAITAAKLNVAPVRRGFWGRMSGLPHTIPCKVTGKCGSV
TPS10002|Rps2        FLKDK-----LQDEVMKIMPVQKQSSAGQRTRFKAFVAVGDAAGHIGLGVKCSSEVATAIRGAILAAKLNIAPVRRGYWGRKASAPHTVPTKVTGKCGSV
CYA10002|RPS2        FLGPR-----LQDEVLKIMPIQKQTQAGQRTRFKAIVVVGDGNGHVGLGVKSAKEVATAIRGAMLAAKLAVVPVRRGFWGSKLGLPHTVPCKVSGKAGSV
DIC10002|RPS2        FLN-------LKDEVMKIVPVQKQTRAGQRTRFKAFVVVGDHNGHVGLGVKCAKEVATAISGAIVAAKLSVIPVRRGYWGNKLGAPHTVPTKVTGKCGSV
PLA10002|RPS2        FFQPNECSHPLKDDVVKIMPVQKQTRAGQRTRFKAFVAIGDGNGHCGLGVKCAKEVATAIRGAIISAKLSLIPVRRGYWGNKIGDPHTVPMKVSGKCGSV
TGO10002|RPS2        FFQPGNCAAPLKDDVMKIMPVQKQTRAGQRTRFKAFVAVGDSNGHCGLGVKCAKEVATAIRGAIIAAKLSLVPVRRGYWGNKIGEPHTVPMKVSGRCGSV
GIA10002|Rps2        FFPKS----ELAEEVCNIMSVQKQTTAGQRTRFRAHVIVGNRDGFIGYGAGVSKEVANAIKKAAKNARLNIVPVRRGFWGGKLGDPHTVSSKLSGKCGSV


HUM10002|RPS2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVA
DOG10002|Rps2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVA
MUS10002|Rps2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVA
RAT10002|Rps2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVA
CHK10002|Rps2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLAKTHTRVSVQRTQAAAVA
FUG10002|RPS2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLAKTHTRVSVQRGQTMQAP
DAN10002|Rps2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLAKTHTRVSVQRTQGALPQ
MED10002|Rps2        LVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLAKTHTRVSVQRGQPVQAA
CIO10002|RPS2        HVRLIPAPRGTGIVSAPVPKKLLSMAGLEDCYTSARGQTATLGNFAKATFNAISKTYSYLTPDLWRDQPLTKAPYQEYTDHLEKNHTSGGVQKQEVKKY-
DRO10002|sop         SVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFLSKPTPRLHADA-------
MOS10002|Rps2        LVRLIPAPRGTGIVSAPVPKKLLQMAGIDDCYTTTRGSTTTLGNFAKATYAAIAKTYAFLTPDLWKDLPLNKTPYQEFADFLDKTNKTGQRVIEM-----
BEE10002|Rps2        QVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSARGSTCTLGNFAKATYAAIAKTYAYLTPDLWHDQALRKAPYQEFADYLSKNHRVVGGQRPAEVV--
CEL10002|rps-2       MVRLIPAPRGTGIVSAPVPKKLLHMAGIEDCYTAAKGSTATLGNFAKATYAALQRTYSYLTPDLWKEEALEKSPYQRHHEYLARN---------------
BMA10002|RPS2        LVRLIPAPRGTGIVSAPVPKKLLQMAGVEDCYTSAVGQTATLGNFAKATYAAIQRTYSYLTPDLWKEQSLEKTPYQRYWEFLAQSAPVRV----------
STE10002|RPS2        RVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTATLGNFAKATFAAISETYAYLTPDMWKETVFTKTPYQEFTDYLSKNHSAGRSAAAAAAAAA
MBR10002|RPS2        RVRLIPAPRGSAIVAAPAPKKLLQMAGIEDCYTSCGGQTATLGNFAKAAFQAISRTYTFLTPDLWADIKLEDSPYDEHSDYLAKNHKVGVAAK-------
NEU10002|Rps2        TVRLIPAPRGTSLVASPAVKRLLQLAGIEDAYTSSSGSTKTLENTLKATFAAVSNTYGFLTPNLWKETKLTRSPLEEFADTLREGKRYAN----------
GRI10002|Rps2        TVRLIPAPRGTALVASPAVKRLLQLAGIEDAYTSSSGSTKTLENTLKATFSAVSNTYGFLTPNLWKETKLIRSPLEEFADTLRDGKRY------------
GRA10002|Rps2        TVRLIPAPRGTGLVASPAVKRFLQLAGVEDAYTSSAGSTKTLENTLKATFVAVSNTYGFLTPNLWKETKLIRSPLDEFADTLREGKRY------------
STA10002|Rps2        TVRLIPAPRGTGLVASPAVKRLLQLAGVQDIYTASAGSTKTLENTLKATFVAVANSYGFLTPNLWAETKLIRSPLEEFSDVLREGKRY------------
YAR10002|Rps2        NVRLIPAPRGSSIVASPAVKKLLQLGGIKDVYTSSAGSTRTLENTLKATFIAIANTYGFLTPNLWTETALTPSPLETHSSFLSSQKRRF-----------
POM10003|RPS2        TVRLVPAPRGAGLVAAPVTKRFLQLAGIEDCYTQSRGSTKTLGNFVKAAFAAASLTYGILTPNLWAERPFGQTPIEEYADILMQTEKKY-----------
YST10003|RPS2        TVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQPLPVSPLDIYSDEASAQKKRF-----------
CIN10002|Rps2        MCRLIPAPRGTGIVAAPASKRLLQLAGIEDSYTQSKGSTATMGNFLKATFAALTKTYAFLTPDLWREIPVSKFPYDEHSAHLQLAAKKVY----------
NEA10002|Rps2        MCRLIPAPRGTGIVAAPASKRMLQMAGIQDCYTQSKGCTATQGNFLKATMAALAKTYQFQSPDLWNVIAPGLTPYDEHSAWLAIAAKKAANY--------
MAY10002|Rps2        MCRLVPAPRGTGIVAAPASKRMLQLAGIEDCYTQSSGQTATMGNFLKATFEAVSKTYAFLTPNLWREIAPPATPYVEFASHLARTQKKSLY---------
RHI10006|Rps2        MSRLVPAPRGTGIVASPTAKRVLQLAGISDCYTSSRGSTRTLGNFIKATFAAIGNTYGFLTPDLWEESEFVKGPYQEFSDFLAQKQRK------------
RHI10007|Rps2-2      MSRLVPAPRGTGIVASPTAKRVLQLAGISDCYTSSRGSTRTLGNFIKATFAAIGNTYGFLTPDLWEESEFVKGPYQEFSDFLAQKQRK------------
RHI10008|Rps2-3      MSRLVPAPRGTGIVASPTAKRVLQLAGISDCYTSSRGSTRTLGNFIKATFAAIGNTYGFLTPDLWEEPEFVKGPYQEFSDFLAQKQRK------------
RHI10009|Rps2-4      MSRLVPAPRGTGIVASPTAKRVLQLAGISDCYTSSRGSTRTLGNFIKATFAAIGNTYGFLTPDLWEESEFVKGPYQEFSDFLAQKQRK------------
ARA10003|RPS2A       TVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLSTKAVSATKVITEGEDQA
ARA10004|RPS2B       TVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLSTKAVSATKVITEGEDQA
ARA10005|RPS2C       TVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLASKALSTSKPDPVVEDQA
ARA10006|RPS2D       TVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSKSPYQEHTDFLLIPPGVKISEVVVDKSVE
RIC10004|RPS2A       TVRMVPAPRGSGIVAAHVPKKVLQFAGIEDVFTSSRGSTKTLGNFVKATFDCLMKTYGFLTPDFWRETRFIKTPFQEYTDLLARP-KGLVIEAPAEKIEA
RIC10005|RPS2B       TVRMVPAPRGSGIVAARVPKKVLQFAGIEDVFTSSRGSTKTLGNFVKATFDCLMKTYGFLTPDFWRDTKFVKSPFQEYTDLLAKPTKALMIDAPVENVEA
GMA10005|LOC10079710 TVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLLKTYGFLTPEFWKETRFSKSPFQEYTDLLAKPTGKALILEEERVEA-
GMA10006|LOC10081036 TVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLMKTYGFLTPEFWKETRFSKSPFQEYTDLLAKPTGKTLILEEERVDA-
GMA10007|LOC10082035 TVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLMKTYGFLTPEFWKETRFSKSPFQEYTDLLAKPTGKTLILEEERVDA-
POP10002|RPS2        TVRMVPAPRGAGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLLKTYGFLTPDFWKETRFIRSPFQEYTDLLAKPTSKVLITEVHED---
CRE10002|RPS2        TIRLTPAPRGAGIVAARTPKKVLQMAGIEDCYTCSRGSTKTLGNFVRATFNALSRTYGFLTPELWRESKYTKAPFQEFTDFLAKPHIGESKGEAYAY---
VOL10002|RPS2        TIRLTPAPRGAGIVAARTPKKVLQMAGIEDCYTCSRGSTKTLGNFVRATFNALSKTYGFLTPDLWRESKYTKAPFQEFTDFLAKPTLGEAKAEAYAY---
HEM10002|rps2        RLRCVPAPKGTGIVAAKIPKKLLTLAGYEDVFTTSKGQTRTFGNFAKATFNAIYLTQKFITPNLWMKSSFLKNPMNF-----------------------
PTR10002|RPS2        RVRLIPAPRGTGLVSSPAGKKLLHMAGVTDCYTSACGHTRTMGNFIKALFYALRSTYGYLSPELWADMPLLATPYQEHTDFLAKKQIK------------
TPS10002|Rps2        RVRLIPAPRGTGLVSSPAGKRLLSMAGIEDCYTSTRGHTRTMGNFIKALFYALRNTYGYLEPDLWKENVLTAAPFQEHTDFLSKKQIK------------
CYA10002|RPS2        TLRLVPAPRGTGIVAAQVPKKILQFAGLQDVYTQCTGHSKTLGNFAKATYDALKKTYSFLTPDLWKETKLMPPPQEQFSVYLSKLEKSTT----------
DIC10002|RPS2        AVRLVPAPRGTGIVAARVPKKLLQYAGVDDVYTSSRGKTRTMGNFVMATFFAITKTFAYLTPDLWREVKLIKTPYQEHSAKLSEKQQ-------------
PLA10002|RPS2        RIRLVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGKTKTKGNFLRAIFNALSKTYGYLTPDLWKVTNFDKSPYEEWSDFLETYQNLKGIKGTV-----
TGO10002|RPS2        RVRLIPAPRGTHIVGAPTTKKILGFAGIKDCFSNSKGSTKTRGNFMKALFDALSQTYGYLTPELWTPTVYTKSPYQEWSDYLARTTKDSAVSRPLA----
GIA10002|Rps2        RVRLIPAPRGAGIVASPTVAKVLEFAGVSDVFTRQSGHSRTLMNSVGAVYNALKSSYSILTPDLWKKEQLDHVQDIRTMSLAD-----------------


HUM10002|RPS2        TT-----------
DOG10002|Rps2        TT-----------
MUS10002|Rps2        TT-----------
RAT10002|Rps2        TT-----------
CHK10002|Rps2        TT-----------
FUG10002|RPS2        AS-----------
DAN10002|Rps2        GTS----------
MED10002|Rps2        TS-----------
CIO10002|RPS2        -------------
DRO10002|sop         -------------
MOS10002|Rps2        -------------
BEE10002|Rps2        -------------
CEL10002|rps-2       -------------
BMA10002|RPS2        -------------
STE10002|RPS2        SAVAAEPAAPKAY
MBR10002|RPS2        -------------
NEU10002|Rps2        -------------
GRI10002|Rps2        -------------
GRA10002|Rps2        -------------
STA10002|Rps2        -------------
YAR10002|Rps2        -------------
POM10003|RPS2        -------------
YST10003|RPS2        -------------
CIN10002|Rps2        -------------
NEA10002|Rps2        -------------
MAY10002|Rps2        -------------
RHI10006|Rps2        -------------
RHI10007|Rps2-2      -------------
RHI10008|Rps2-3      -------------
RHI10009|Rps2-4      -------------
ARA10003|RPS2A       -------------
ARA10004|RPS2B       -------------
ARA10005|RPS2C       -------------
ARA10006|RPS2D       -------------
RIC10004|RPS2A       -------------
RIC10005|RPS2B       -------------
GMA10005|LOC10079710 -------------
GMA10006|LOC10081036 -------------
GMA10007|LOC10082035 -------------
POP10002|RPS2        -------------
CRE10002|RPS2        -------------
VOL10002|RPS2        -------------
HEM10002|rps2        -------------
PTR10002|RPS2        -------------
TPS10002|Rps2        -------------
CYA10002|RPS2        -------------
DIC10002|RPS2        -------------
PLA10002|RPS2        -------------
TGO10002|RPS2        -------------
GIA10002|Rps2        -------------