CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10030|RPS27A      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
DOG10029|Rps27a      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
MUS10029|Rps27a      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
RAT10029|Rps27a      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
CHK10030|Rps27a      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
FUG10030|RPS27A      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
DAN10029|Rps27a      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
MED10029|Rps27a      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-SYTTPKKNKHKR
CIO10029|RPS27A      --MQIFVKTLTGKTITLEVEASDSIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGG-KKRKKKTYTTPKKIKHKR
DRO10037|RpS27A      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-NYSTPKKIKHKR
MOS10029|Rps27a      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-NYSTPKKIKHKR
BEE10029|Rps27a-1    --MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPGQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-NYSTPKKIKHKK
CEL10093|ubl-1       ----MVFVKTLHRTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYA--GRQLEDS----DCGIDSEATIYVNLELLGGAKKRKKK-VYTTPKKNKRKP
BMA10029|RPS27A      --MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GGKKRKKKVYTTPKKNKHKR
STE10029|RPS27A      --MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKK-NYTTPKKIKHKK
MBR10029|RPS27A      --MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKK-NYTTPKKIKHKH
NEU10029|Rps27a      --MQIFVKTLTGKTITLEVESSDTIDNVKQKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GGKKRKKKVYTTPKKIKHKR
GRI10029|Rps27a      --MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GGKKRKKKVYTTPKKIKHKR
GRA10030|Rps27a      --MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGMAKKRKKKVYTTPKKIKHKR
STA10029|Rps27a      --MQIFVKTLTGKTITLEVEASDTIDNVKSKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GAKKRKKKVYTTPKKIKHKR
YAR10030|Rps27A      --MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GGKKRKKKVYTTPKKIKHKR
YST10050|RPS31       --MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GGKKRKKKVYTTPKKIKHKH
CIN10029|Rps27A      --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GAKKRKKKQYSTPKKIKHKR
NEA10029|Rps27a      --MQIFVKTLPGKTLARDVLPTSTVSSVKEMIASAEGIPASEQRLIFA--GVQMDDERALAEYGIQKESTINMVMSLCGGGKKRKKK-NYTTPKKIKHKR
MAY10029|Rps27a      --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GAKKRKKKVYSTPKRIPHKR
RHI10110|Rps27A      --MQVFVKSLEGNTITLDVSSNTSIAVVKSLIEEREGLPVNSQCLSYA--GKPLIEG-ELALYGIANNNTLHLNAELLGGGKKRKKK-TYTTPKKIKHKR
RHI10111|Rps27A-2    --MQVFVKSLEGNTLTLNVSSNTSVAAVKSLIEEREGLPVNSQCLSYA--GKPLIEG-ELALYGIANNNTLNLNAELLGGGKKRKKK-TYTTPKKIKHKR
RHI10112|Rps27A-3    --MQLFVKSLAGNTLAFEVAPSASVENVKAMIAAREGIDASFQCLSFA--GKSLQDSQAISMYGVQDNSTLHLNAELLGGGKKRKKK-TYTTPKKIKHKR
RHI10113|Rps27A-4    --MQLFVKSLAGNTLAFEVAPSASVENVKAMIAAREGIDASFQCLSFA--GKSLQDSQSISMYGVQDNSTLHLNAELLGGGKKRKKK-TYTTPKKIKHKR
ARA10081|RPS27Aa     --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHTH
ARA10082|RPS27Ab     --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKH
ARA10083|RPS27Ac     --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKH
RIC10099|RPS27Ab     --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKQKHKH
RIC10100|RPS27Ac     --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKH
GMA10144|LOC10052785 --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKH
GMA10151|LOC10052757 --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKH
GMA10152|LOC10078430 --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKH
GMA10153|LOC10078575 --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKH
POP10029|RPS27A      --MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK-TYTKPKKIKHKK
CRE10029|RPS27A      --MQIFVRTDR--THLVEVSPAQTVADVKAAVEALQGLEAGEQRILFN--GVQLEDSQVLAEAGVSDDSTLMCLLRLLGGAKKRKKK-TYTKPKKQKHKH
VOL10032|RPS27A      --MQIFVRTDR--THLLEVSPAQTVADVKAAVEAIQGLEAAEQRILLN--GVQLEDSQVLAEAGVSDDSTLMCLLRLLGGAKKRKKK-TYTKPKKQKHKH
HEM10026|rps27A      -----------MKLVCPKIEKKNKNSLTLDKTLNFETKIKYSKKIIAKNWFFIKNFLNIFKKYSSTTKYQRHPNFELKGGGKKRKKK-TYTKPKKIKHIR
PTR10030|RPS27A      --MQIFVKTLTGKTITLDVEPSDTIDNVKTKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GGKKRKKKVYTKPKKVKRVN
TPS10029|Rps27a      --MQIFVKTLTGKTITLDVEPSDTIDNVKTKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRG-GGKKRKKKVYTKPKKAKRVN
CYA10030|RPS27A      MRRQLLVQCPNGRIVSTNVLATDSLAVVLSRVTGLDADAVYGTVAGGRPVATLRDALVNFTDPEAPIVIQAH--VRVLGGGKKRKKK-TYTTPKKIKHKH
DIC10029|RPS27A      --MQIFIKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFA--GKQLEDGRTLSDYNIQKESTLHLVLRLRGGGGKKKKKKTYATPKVLKRKL
PLA10034|RPS27A      --MKILINIPYDESLCLESSNINNIKNVKEQIFELKGIPYELQKLYKN--GRHLEDEELLEIDKSDYAYTLNLNFGLLGGAKKKKKK-VYKKPKKEKHKK
TGO10029|RPS27A      --MQIFVLSVGGDTLALEVAPTSTIRDVKEQLQARQGIEADDQRLCFG--LHALEDDETLGELGVEEECTLYQSLELLGAGKKRKKK-TYTKPKKQKHKK
GIA10029|Rps27a      ---MLVIVRLQDQTLPFELPAGARASQLSNLLSSSGMAFSLHTQGRVLSEAAELNDKMVIDAFVPADG----------AGKDKKRKKKAHKTPKKIKHEP
HAL10040|VNG2047G    ----------------------------------------------------------------------------------------------------
MET10023|MJ0393      --------------------------------------------------------------------------------------------------MT
SUL10047|STS051      -------------------------------------------------------------------------------------------VVKVPKNKD


HUM10030|RPS27A      KKVKLAVLKYYKVDENG-KISRLRRECPSDECGAGVFMASHFD---RHYCGKCCLTYCFNKPEDK------------------------------
DOG10029|Rps27a      KKVKLAVLKYYKVDENG-KISRLRRECPSDECGAGVFMASHFD---RHYCGKCCLTYCFNKPEDK------------------------------
MUS10029|Rps27a      KKVKLAVLKYYKVDENG-KISRLRRECPSDECGAGVFMGSHFD---RHYCGKCCLTYCFNKPEDK------------------------------
RAT10029|Rps27a      KKVKLAVLKYYKVDENG-KISRLRRECPSDECGAGVFMGSHFD---RHYCGKCCLTYCFNKPEDK------------------------------
CHK10030|Rps27a      KKVKLAVLKYYKVDENG-KISRLRRECPSEECGAGVFMASHFD---RHYCGKCCLTYCFNKPEDK------------------------------
FUG10030|RPS27A      KKVKLAVLKYYKVDENG-KIHRLRRECPADECGAGVFMASHFD---RHYCGKCCLTYCFNKPEDK------------------------------
DAN10029|Rps27a      KKVKLAVLKYYKVDENG-KIHRLRRECPADECGAGVFMASHFD---RHYCGKCCLTYCFNKPEDK------------------------------
MED10029|Rps27a      KKVKLAVLKYYKVDENG-KIHRLRRECPADECGAGVFMASHFD---RHYCGKCTLTYCFNKPEDK------------------------------
CIO10029|RPS27A      VKVKLATLKYYKVDENG-KISRLRRECPNTECGAGVFMASHFD---RQYCGKCALTYVFKPENQ-------------------------------
DRO10037|RpS27A      KKVKLAVLKYYKVDENG-KIHRLRRECPGENCGAGVFMAAHED---RHYCGKCNLTFVFSKPEEK------------------------------
MOS10029|Rps27a      KKVKLAVLKYYKVDENG-KIHRLRRECTSESCGAGVFMAAHED---RHYCGKCHLTLVYSKQEEK------------------------------
BEE10029|Rps27a-1    KKVKLAVLKFYKVDENG-KIHRLRRECPMEQCGAGVFMAAMED---RHYCGKCGYTLVFNKPEDK------------------------------
CEL10093|ubl-1       KKVKLAVLKYYKIDENG-KITRLRKECQQPSCGGGVFMAQHAN---RHYCGRCHDTLVVDTATAAATSGEKGGKKGKK-----------------
BMA10029|RPS27A      KKVKLAVLKYYKVDENG-KITRLRKECASPSCGGGVFMASHQN---RYYCGKCHRTLVMQDPKEKAIGKAK------------------------
STE10029|RPS27A      KKVKLAVLKYYKVDENG-KITRLRRECPSESCGAGVFMASHFD---RQYCGKCCLTYVFSKPQEGK-----------------------------
MBR10029|RPS27A      KNVKLAALKFFKVDANG-KVTRLRRECPAEECGAGVFMANHFD---RQYCGKCGLTYFADDQKK-------------------------------
NEU10029|Rps27a      KKTKLAVLKYYKVDSDG-KIERLRRECPNETCGAGVFMAAMQD---RQYCGRCHLTYVFEKSS--------------------------------
GRI10029|Rps27a      KKTKLAVLKYYKVDGDG-KIERLRRECPNETCGAGIFMAAMQD---RQYCGRCHLTYVFDKKD--------------------------------
GRA10030|Rps27a      KKTKLAVLKYYKVDSDG-KIERLRRECPSDTCGAGVFMAAMQD---RQYCGRCHLTYVFDKQ---------------------------------
STA10029|Rps27a      KKTKLAVLKYYKVDGDG-KIERLRRECPQPECGAGVFMAAMHN---RQYCGRCHLTYVFDEAK--------------------------------
YAR10030|Rps27A      KKNKLAVLNLYKVDDDG-KVERLRRECESESCGAGVFMADMKD---RQYCGRCHLTLKA------------------------------------
YST10050|RPS31       KKVKLAVLSYYKVDAEG-KVTKLRRECSNPTCGAGVFLANHKD---RLYCGKCHSVYKVNA----------------------------------
CIN10029|Rps27A      KKVKMSILKYYKVDSDG-KIKRLRRECPSAECGAGIFMAFHKD---RQYCGKCGLTYTFTPGTKPPVV---------------------------
NEA10029|Rps27a      KKVKMAILKYYKVGSDG-KIQRLRRECPAPTCGAGIFMAWHKD---RQACGKCGLTYTFEPGTKPTTA---------------------------
MAY10029|Rps27a      KKVKMSILKYYKVDGDG-NIKRLRRECPSPECGAGIFMSWHRN---RQYCGKCKLTFMFEEGTKPPTA---------------------------
RHI10110|Rps27A      KKVKMAILKYYKVDESG-KITRLRRECPNATCGAGVFMAKHKD---RQYCGKCHLTYVFQKGESA------------------------------
RHI10111|Rps27A-2    KKVKMAILKYYKVDESG-KITRLRRECPNATCGAGVFMAKHKD---RQYCGKCHLTYVFQKGESA------------------------------
RHI10112|Rps27A-3    KKVKMAILKYYKVDESG-KITRLRRECPNATCGAGVFMAKHKD---RQYCGKCHLTYVFQKDQQA------------------------------
RHI10113|Rps27A-4    KKVKMAILKYYKVDESG-KITRLRRECPNATCGAGVFMAKHKD---RQYCGKCHLTYVFQKDQQA------------------------------
ARA10081|RPS27Aa     KKVKLAVLQFYKVDGSG-KVQRLKKECPSVSCGPGTFMASHFD---RHYCGKCGTTYVFKKADEE------------------------------
ARA10082|RPS27Ab     KKVKLAVLQFYKVDGSG-KVQRLRKECPNATCGAGTFMASHFD---RHYCGKCGLTYVYQKEGAQE-----------------------------
ARA10083|RPS27Ac     KKVKLAVLQFYKIDGSG-KVQRLRKECPNATCGAGTFMASHFD---RHYCGKCGLTYVYQKEGVEA-----------------------------
RIC10099|RPS27Ab     KKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFD---RHYCGKCGLTYVYNQQA--------------------------------
RIC10100|RPS27Ac     KKVKLAVLQFYKVDDATGKVTRLRKECPNNDCGAGTFMANHFD---RHYCGKCGLTYVYNQKA--------------------------------
GMA10144|LOC10052785 KKVKLALLQFYKVDDSG-KVQRLRKECPNAECGAGTFMANHFD---RHYCGKCGLTYVYQKAEA-------------------------------
GMA10151|LOC10052757 KKVKLGILQFYKVDDSG-KVQRLRKECPNAECGAGTFMANHFD---RHYCGKCGLTYVYQKADA-------------------------------
GMA10152|LOC10078430 KKVKLGILQFYKVDDSG-KVQRLRKECPNAECGAGTFMANHFD---RHYCGKCGLTYVYQKADA-------------------------------
GMA10153|LOC10078575 KKVKLALLQFYKVDDSG-KLQRLRKECPNAECGAGTFMANHFD---RHYCGKCGLTYVYQKSEA-------------------------------
POP10029|RPS27A      KKVKLAVLQFYKVDDSG-KVQRLRKECPNAECGAGTFMANHFD---RHYCGKCGLTYVYQKAGGD------------------------------
CRE10029|RPS27A      KKIKLRVLKFYKVDDSG-KVQRLRKQCPN--CGPGTFMATHFD---RVYCGKCANTFVYEGGAPAGAPKKSGGAAAAAAPAPAAEAGGKGKKGKK
VOL10032|RPS27A      KKIKLRVLKFYKVDDSG-KVQRLRKQCPN--CGPGTFMATHFD---RVYCGKCANTFVYEGGAPAGAPKPKP-AAAPAAAAPEAPAGKGGKKGKK
HEM10026|rps27A      KKIKLKTLNYYSVDDG--KIKKLRRESPQS---PGSFMAEHSD---RLTCGKTGLTLVRKD----------------------------------
PTR10030|RPS27A      KTIPLQTLKYYRVESDG-KVTRLRKYSPVAGIG--CFMAQHVD---RYYCGKSGTTFMYDDMKESE-----------------------------
TPS10029|Rps27a      KTIPLQTLKYYRVEDGG-KVVRLRKYSPVAGIG--CFMAQHHD---RYYCGKSGTTFLYEDMKE-------------------------------
CYA10030|RPS27A      KKVKLATLKYYAVDDAN-KVTRLRKECPNESCGAGVFMAQHRD---RIYCGKCGLTYVQEDNA--------------------------------
DIC10029|RPS27A      RKVKLAVLKYYKFDENG-KIKRVLRECPAETCGAGVFMAQHAN---RQYCGKCHSTLVKKSK---------------------------------
PLA10034|RPS27A      KKVKLAVLKFYKVGDDG-KVFRLKRQCDN--CAPGTLMASHFD---RDYCGRCHLTIMKK-----------------------------------
TGO10029|RPS27A      KKVKLAVLKFYKVDGND-KVTRLRKECPRETCGAGVFMAAHKN---RTYCGRCGLTYILNAEE--------------------------------
GIA10029|Rps27a      KKVRLACLKYYTIKGDTAEPTR----EYCPNCGPGIRIARHAD---RCHCGRCGFAK--------------------------------------
HAL10040|VNG2047G    ----MARGDYYSDDGTTDK-------EMCPRCG-DTFLAAHDD---RQVCGRCGYTEWE------------------------------------
MET10023|MJ0393      KGKKTAKYKYYKIEGDK--VIRLKKTCPR--CGPGVFMAEHLN---RYACGKCGYMEWKQPQKKE------------------------------
SUL10047|STS051      ESQKAIVRTYYIIEGDK--IKLKNKKCPR----CGSIMAHHMKPVERWACGKCGYTEFIGKGK--------------------------------