CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10001|VNG1143G    MSENESDTEAELEENAPDEAAADAESTAQTDEQTPDTEADEPAPESTATEDVMSDEEADLLIPVEDYLGAGVHIGTQQKTN--DMDRFIHRVRTDGLYVL
MET10001|MJ0982      ------------------------------------------------------MSEKELLVPLDTYLASGIHIGTQQKTK--DMEKFIYRVRSDGLYVL
PYR10001|PH1629      ----------------------------------------------------VCDMADEYLVPLDQYLAAGVHIGTQQKTK--DMKKFIYRVRQDGLYVL
THE10002|TTHA0861    ---------------------------------------------------------MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAER-NGIHII
SYN10003|sll1260     ----------------------------------------------------------MPVVSLADLLESGVHFGHQTRRWNPRMDQYIYTAR-NGVHII
BAC10002|Bsu1650     ----------------------------------------------------------MSVISMKQLLEAGVHFGHQTRRWNPKMKRYIFTER-NGIYII
ECO10002|rpsB        ----------------------------------------------------------MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGAR-NKVHII
SUL10001|ST2063      -------------------------------MSEKEKEGQLSEEEKAELQKSEKGAVIELLVPLDTYLSAGVHIGTHTCTK--YMEKFVYRVRPEGLYVL


HAL10001|VNG1143G    DVSRTDDRVRTAADFLANYDPE--QILVTSSRQYGRFPAEKFAEAVGARARTGRFIPGTLTNPDYDG---------------------------------
MET10001|MJ0982      DVRKTDERLRIAAKFLARYEPE--DILAVSRRIYTMGPLEEFGKYTGIRTVAGRFVPGTLTNPAYKG---------------------------------
PYR10001|PH1629      DVRKTDERLKVAGKFLARFEPQ--SILAVSVRLYGQKPVKKFGEVTGARAIPGRFLPGTMTNPAVKN---------------------------------
THE10002|TTHA0861    DLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHEL
SYN10003|sll1260     DLVQTAQLMEDAYEYVRSSTINGKKFLFVGTKRQAAGIISQEAQRCGAHYVNQRWLGGMLTNWETIRKRVDRLKELEALEASGGIDRRGKKEGSMLRREL
BAC10002|Bsu1650     DLQKTVKKVEEAYNFTKNLAAEGGKILFVGTKKQAQDSVKEEAQRSGMYYVNQRWLGGTLTNFETIQKRIKRLKDIEKMQENGTFDVLPKKEVVQLKKEL
ECO10002|rpsB        NLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTREL
SUL10001|ST2063      DVRKIDERLRIAARFLSRFTPE--NILAVTSRPYAFTPVTKFAEVIRGRAIVGRFPPGILTNPQLPN---------------------------------


HAL10001|VNG1143G    -------------YIEPDVLVVTDPIGDSQAVKEAITVGIPVIAMCDSNNQTGNVDLVVPTNNKGRRALSVVYWLLANETLDRRGA--------------
MET10001|MJ0982      -------------FMEPEVVFISDPRVDRQALKEATEIGVPIVGLCDTEHLTSFIDLVIPTNNKGKKAVALIYYLLTREYLKNRGV--------------
PYR10001|PH1629      -------------FFEPEVIIITDPRADHQAMKEAIEIGIPIVALVDTENLLSYVDLAIPTNNKGRKALALIYWILAREILYNRGE--------------
THE10002|TTHA0861    ERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGG--------------
SYN10003|sll1260     GKLQKYLGGIKNMRKLPDVVVIVDQRREHNAIHECQKLGIPIIAMLDTNCDPDVVDVPIPANDDAIRSIKLIVGKLADAIYEGRHGQPDVSDDYEEFDEG
BAC10002|Bsu1650     ERLEKFLGGIKDMKDLPDALFIIDPRKERIAVAEARKLNIPIIGIVDTNCDPDEIDVVIPANDDAIRAVKLLTSKMADAILEAKQG--------------
ECO10002|rpsB        EKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRS---------------
SUL10001|ST2063      -------------HIEPEVIVATDPRTDLQAIKEASKVGIPVVAFADTDAKVDFVDFIIPANNKGRKSLALLYWVLARQILRERRE--------------


HAL10001|VNG1143G    ---EPTYG-----LDDFEDGL----------------------
MET10001|MJ0982      ---ITDDTKLPFTYEEFLEKAANPKYRIIIQPKDKRRRRRRRK
PYR10001|PH1629      ---ISSREEFKIPVEEFEMKIVRR-------------------
THE10002|TTHA0861    ---VVEPSPSYALVQEAEATETPEGESEVEA------------
SYN10003|sll1260     LDGDNLEVEAAEEVEEAAEAEVAATPEA---------------
BAC10002|Bsu1650     ---EEEAEVAEETAPETETTTA---------------------
ECO10002|rpsB        ---QDLASQAEESFVEAE-------------------------
SUL10001|ST2063      ---IPPEGEIPQRVEDFETRLVE--------------------