CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10003|RPS3        -----------------------------MAVQISKKRKFVADGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
DOG10003|Rps3        -----------------------------MAVQISKKRKFVADGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
MUS10003|Rps3        -----------------------------MAVQISKKRKFVADGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
RAT10003|Rps3        -----------------------------MAVQISKKRKFVADGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
CHK10003|Rps3        -----------------------------MAVQISKKRKFVADGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
FUG10003|RPS3        -----------------------------MAVQISKKRKFVSDGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
DAN10003|Rps3        -----------------------------MAVQISKKRKFVSDGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
MED10003|Rps3        -----------------------------MAVQISKKRKFVSDGIFKAELNEFLTRELAED-GYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT
CIO10003|RPS3        -----------------------------MAAQISKKRKFVNDGLFKAELNELLWRELAED-GYSGVEVRVTPSRTEIIILATRTQNVLGEKGRRIRELT
DRO10003|RpS3        ---------------------------MNANLPISKKRKFVSDGIFKAELNEFLTRELAED-GYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELT
MOS10003|Rps3        -----------------------------MYNTVSKKRRFVANGMFHAELNEFLTRELAED-GYSGVEVRVTPTRTEIIIMATRTQNVLGEKGRRIRELT
BEE10003|Rps3        ----------------------------MDNRSISKKRKFVGDGVFKAELNEFLTRELSED-GYSGVEVRVTPHRTEIILLATHTQSVLGEKGRRIRELT
CEL10003|rps-3       ---------------------------MAANQNVTKKKKAVIGGIFKAELNNFLMKELAED-GYSGVEVRSTPARAEVIIMATRTQNVLGERGRRIKELT
BMA10003|RPS3        --------------------------MIVTTQEMSKKRKAVQDGIFKAELNNFLMKELAED-GYSGVEVRRTPARAEIIILATRTQSVLGERGRRIRELT
STE10003|RPS3        -----------------------------MAAQISKKRKFVADGLFKAELNEFLTRELAED-GYSGVEVRVTPIRTEIIILATRTQNVLGEKGRRIRELT
MBR10003|RPS3        ----------------------------MAQHQMSKKRKFVADGVFKAELNELFMRELAED-GYAGVEIKKTPKSTEIVILATRTQHVLGEKGRRIRELT
NEU10003|Rps3        --------------------------MAVPGTQISKRRKFVADGVFYAELNEFFQRELAEE-GYSGVEVRVTPTVTDIIIRATHTQEVLGEQGRRIRELT
GRI10003|Rps3        -------------------------MATPGAAQISKRRKFVADGVFYAELNEFFQRELAEE-GYSGVEVRVTPTVTDIIIRATHTQEVLGEQGRRIRELT
GRA10003|Rps3        --------------------------MAHPGSQISKRRKFVADGVFYAELNEFFQRELAEE-GYSGVEVRVTPTVTDIIIRATHTQEVLGEQGRRIRELT
STA10003|Rps3        --------------------------MATTQGAISKRRKFVADGVFYAELNEFFQRELAEE-GYSGVEVRVTPTVTDIIIRATHTQEVLGEQGRRIRELT
YAR10003|Rps3        ---------------------------MSSTVTISKKRKIVADGVFYAELNEFFTRELAEE-GYSGVEVRLTPTKTEIVVRATHTNKVLGENGRRIRELM
POM10004|RPS3        ---------------------------MSAAFTISKKRKFVADGVFYAELNEFFTRELSEE-GYSGCEVRVTPSRSEIIIRATHTQDVLGEKGRRIRELT
YST10004|RPS3        -----------------------------MVALISKKRKLVADGVFYAELNEFFTRELAEE-GYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELT
CIN10003|Rps3        -----------------------------MASQISKKRKFVADGVFRAELNEFFTRELAEE-GYSGCDVRVTHARTEIIIRATHTQEVLGEKGRRIRELT
NEA10003|Rps3        ---------------------------MSASQIISKRRKFVADGVFQAELNDFFTRELAEE-GYAGCEVRVTHARTEIIIRATHTQEVLGDKGRRIRELK
MAY10003|Rps3        ----------------------------MASANISKKRKFVADGVFAAELNEFFTRELSEE-GYSGCEVRVTHARTEIIIRATHTQEVLGDKGRRIRELT
RHI10010|Rps3        --------------------------MAAVAAQISKKRKFVADGVFYAELNEFLTRELAEA-GYAGVEVRVTPARTEIIIRATHTQNVLGEKGRRIRELT
RHI10011|Rps3-2      --------------------------MAAVAAQISKKRKFVADGVFYAELNEFLTRELAEA-GYAGVEVRVTPARTEIIIRATHTQNVLGEKGRRIRELT
RHI10012|Rps3-3      ----------------------------MAAVQISKKRKFVADGVFYAELNEFLTRELAEA-GYAGVEVRVTPARTEIIIRATHTQNVLGEKGRRIRELT
RHI10013|Rps3-4      ----------------------------MAAVQISKKRKFVADGVFYAELNEFLTRELAEA-GYAGVEVRVTPARTEIIIRATHTQNVLGEKGRRIRELT
ARA10007|RPS3A       -----------------------------MATQISKKRKFVADGVFYAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
ARA10008|RPS3B       -----------------------------MTTQISKKRKFVADGVFYAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
ARA10009|RPS3C       -----------------------------MATQISKKRKFVADGVFYAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
RIC10008|RPS3B       -----------------------------MATQISKKKKFVSDGVFYAELNEMLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
RIC10009|RPS3A       ---------------------------MATHTQISKKRKFVADGVFFAELNEMLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
GMA10008|LOC10080870 -----------------------------MATQMSKKRKFVADGVFFAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELT
GMA10009|LOC10079504 -----------------------------MATQMSKKRKFVADGVFFAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELT
GMA10010|LOC10079558 -----------------------------MASQMSKKRKFVADGVFFAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELT
GMA10011|LOC10080074 -----------------------------MATQMSKKRKFVADGVFFAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELT
GMA10012|LOC10079915 -----------------------------MATQMSKKRKFVADGVFFAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELT
GMA10013|LOC10049973 -----------------------------MATQMSKKRKFVADGVFFAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELT
POP10003|RPS3        -----------------------------MATQISKKRKFVADGVFYAELNEVLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
CRE10003|RPS3        -----------------------------MAVQISKKRKFVQDGVFYAELNELLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
VOL10003|RPS3        -----------------------------MAVQISKKRKFVADGVFYAELNELLTRELAED-GYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELT
HEM10003|rps3        MNTFFVKKINKFLLNFFLKYKKENKYFLKMNKKLSKQKKFINDGVFFSELNELLSRELSDE-GYTNVEIRKAPLKTEIILKMTQTHSILGSRGRRIKEIN
PTR10003|RPS3        -------------------------MTHRGNKRMSVKRKFVADGVFYAELNELLTAELAEE-GYAGVEVRTTPHRTELIIRATRTQNVLGENNRRIRELT
TPS10003|Rps3        ---------------------------MANRSKMSIKRRFVADGVFYAELNELLTRELAED-GYAGVEVRTTPHRTEIIIRATKTQNVLGEKGQRIRELT
CYA10003|RPS3        --------------------------MEAGRRQVSWKRKFVADGVFFAELSELLTRELAED-GYAGVEVRVTPRGHEVIIRATRTQTVLGEKGRRIRELT
DIC10003|RPS3        ---------------------------MNSSLQISKKRKFVADGVFHAELNELFTREFNKDEGYSGVELKTSPGLTEIIIRASKTQAVVGPNARRIQELC
PLA10003|RPS3        -----------------------------MSAPISKKRKFINDGVFQAELNEFLARILAED-GYSGVEVRVTPIRTEVIIRATRTREVLGDKGRRIRELT
TGO10003|RPS3        ---------------------------MASTGNTCKKRKFVKDGVFQAELNEFLSCTLSED-GYSGVEVRVTPIRTEIIIRATRTREVLGDKGRRIRELT
GIA10003|Rps3        -----------------------MPRIVRRDEENVYYSKYLNDCIMEAELHEFFSRELVDA-GYASCSLCRTIDSICVIIQCAEPEVVMGDNHYRLHKIE


HUM10003|RPS3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
DOG10003|Rps3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
MUS10003|Rps3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
RAT10003|Rps3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
CHK10003|Rps3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
FUG10003|RPS3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
DAN10003|Rps3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
MED10003|Rps3        AVVQKRFGFPEGS-VELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVD
CIO10003|RPS3        AMVQKRFKFKDDG-VELYAEKVANRGLCATAQCESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKAMKFVDGLMIHSGDPVREYVD
DRO10003|RpS3        AMVQKRFNFETGR-IELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVE
MOS10003|Rps3        AVVRKRFGFAPGS-VELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNEYVD
BEE10003|Rps3        SVVQKRFNFKETQNIELYAEKVATRGLCAIAQAESLRFKLIGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGEPTNEYVN
CEL10003|rps-3       SVVQKRFGFEEGS-VELYAEKVSNRGLCAVAQCESLRYKLVGGLAVRRACYGVLRFIMESGAQGVEVIVSGKLRGQRAKAMKFVDGLMIHSGHPVNDYIQ
BMA10003|RPS3        SVVQKRFGFADGT-VELYAEKVTNRGLCAVAQCESLRYKLVGGLAVRRACYGVLRFIMESNAQGCEVIVSGKLRGQRAKSMKFVDGLMIHSGQPVNDYIQ
STE10003|RPS3        SVVQKRFGFPEGS-VELYAEKVATRGLCAIAQCESLRYKLIGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMVHAGEPTTHYVD
MBR10003|RPS3        AFIQKRFGFQKDE-VELFAEKVANRGLCAVAQCENLRYKLTGGLAVRRACYGVVRFVMESGAKGCEVIVSGKLRAQRAKAMKFGDGFMISSGNPTREYID
NEU10003|Rps3        SLIQKRFKFPENS-VSLYAAKVQNRGLSAVAQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARAKSMKFTDGFMIHSGQPAKDFID
GRI10003|Rps3        SLIQKRFKFPADS-VSLYAAKVQNRGLSAVAQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARAKSMKFTDGFMIHSGQPAKDFID
GRA10003|Rps3        SLIQKRFKFPENS-VSLYAAKVQNRGLSAVAQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARAKSMKFTDGFMIHSGQPAKDFID
STA10003|Rps3        SLIQKRFKFPENS-VSLYAAKVQNRGLSAVAQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARAKSMKFTDGFMIHSGQPAKDFID
YAR10003|Rps3        SLVQKRFRLPEGS-VTIYAERVQERGLSAVAQCESVKYKLLNGLAIRRAAYGVVRYVMDAGAKGVEVVVSGKLRAARAKSMKFADGFMIHSGQPVNDFID
POM10004|RPS3        ALVQKRFKFAENT-VELYAEKVQNRGLCAVAQCESLRYKLLAGLAVRRAAYGVLRYVMEAGAKGCEVVISGKLRAARAKSMKFADGFMIHSGQPAVDFID
YST10004|RPS3        LLVQKRFKYAPGT-IVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFID
CIN10003|Rps3        ALVQKRFKFPENS-LELYAEKVQYRGLSAIAQCESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVVVSGKLRAARAKSMKFTDGFMIHSGQPALEFVD
NEA10003|Rps3        ALIEKRFKFPENA-LELYAEKVQYRGLSATAQAESLRYKLLGGLAMRRACYGVLRFVMESGAKGCEVVVSGKLRAARAKSMKFTEGFMVHSGQPARDFID
MAY10003|Rps3        ALVQKRFKFPDNS-LELYAEKVQNRGLHAVAQCESLRYKLLGGLAVRRAAYGVLRFVMESGAKGCEVVISGKLRAARAKSMKFTDGFMIHSGQPVKDFVD
RHI10010|Rps3        TLVQKRFKFPENA-VELYAERVQNRGLCAIAQCESVKFKLLNGLAVRRACYGVIRFVMESGAKGCEVVVSGKVRAARAKAMKFADGFMIHSGNPAREFIT
RHI10011|Rps3-2      TLVQKRFKFPENA-VELYAERVQNRGLCAIAQCESVKFKLLNGLAVRRACYGVIRFVMESGAKGCEVVVSGKVRAARAKAMKFADGFMIHSGNPAREFIT
RHI10012|Rps3-3      TLVQKRFKFPENA-VELYAERVQNRGLCAIAQCESVKFKLLNGLAVRRACYGVIRFVMESGAKGCEVVVSGKVRAARAKAMKFADGFMIHSGNPAREFIT
RHI10013|Rps3-4      TLVQKRFKFPENA-VELYAERVQNRGLCAIAQCESVKFKLLNGLAVRRACYGVIRFVMESGAKGCEVVVSGKVRAARAKAMKFADGFMIHSGNPAREFIT
ARA10007|RPS3A       SLVQKRFKFPVDS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSSGQPTKEYID
ARA10008|RPS3B       SLVQKRFKFPVDS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSSGQPTKEYID
ARA10009|RPS3C       SLVQKRFKFPQDS-VELYAEKVANRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSSGQPTKEYID
RIC10008|RPS3B       SVVQKRFNFPENG-VELYAEKVVNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVNEYID
RIC10009|RPS3A       SVVQKRFNFPENG-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGYPVNLYID
GMA10008|LOC10080870 SVVQKRFKFPENS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYID
GMA10009|LOC10079504 SVVQKRFKFPENS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYID
GMA10010|LOC10079558 SVVQKRFKFPENS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYID
GMA10011|LOC10080074 SVVQKRFKFPENS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYID
GMA10012|LOC10079915 SVVQKRFKFPENS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYID
GMA10013|LOC10049973 SVVQKRFKFPENS-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYID
POP10003|RPS3        SVVQKRFKFPENG-VELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVKEYID
CRE10003|RPS3        SVVQKRFNFPPDS-VELYAEKVSDRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSSGNPAKVYID
VOL10003|RPS3        SVVQKRFNFPADS-VELYAEKVLDRGLCAVAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSSGNPAKVYID
HEM10003|rps3        GLIKKRFQFDEKS-LEIYVEKIINKNLCAISQAESLRYKLLRGMVIRRACYSTLKSTMESGAKGCIISVSGKLRAQRAKTMKFIDGYIIHSGKPVEDYIE
PTR10003|RPS3        SVVQKRFNFADGA-VELYAERVQNRGLCAQAQAESLKFKLLGGLAVRRACYGVVRFVMEAQAKGCEVVVTGKLRGQRAKGMKFGDGYMIKTGHAGQVYTD
TPS10003|Rps3        SVVQKRFDFAEGA-VELYAERVQNRGLCAQAQAESLKFKLLAGLAVRRACYGVVRFVMEASAKGCEVIVSGKLRGQRAKGMKFGDGYMIKTGHAGQVYTD
CYA10003|RPS3        ALVEKRFG-FPENQVSLFVERVPNRGLCAMAQAESLRYKLLGGLAVRRAAYGVLRFVMESGAKGCEVQISGKLRAQRAKTMKFMDGYMISTGQPKLDFID
DIC10003|RPS3        SLVQKRFNFKEGT-VVLFAEKILNRGLCAVAQAESLKLKLLAGLPVRKACYAIVHQIMTRGAKGCEVIVSGKLRAQRAKSMKFRDGYMIKSGQPSKDFID
PLA10003|RPS3        SLVQKRFFNKSTNSVELFAERVEHRGLCAMAQAESLRYKLLKGLAVRRACYGVLRHIMESGAKGCEVIVSGKLRAQRAKSMKFRDGYLISTGEPSKRFVN
TGO10003|RPS3        SVVQKRFG-FAPDSVELFAERVENRGLCAMAQAESLRYKLLKGLAVRRACYGVLRHIMESGAKGCEVVVSGKLRAQRAKSMKFKDGYLISTGEPSKMFVD
GIA10003|Rps3        YLLAGRFMCDPKN-FNIWVDKIIKRGLSAEIMVDNLRAKLEEAMPIRRAAYSIIRTAMRAGAAGCEVIVAGKLRAQRARANKFKEGCLISTGHPKRIFLA


HUM10003|RPS3        TAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA-----------------------
DOG10003|Rps3        TAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA-----------------------
MUS10003|Rps3        TAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA-----------------------
RAT10003|Rps3        TAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA-----------------------
CHK10003|Rps3        TAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKEEILPTTPISEQKGGKPEQPAMPQPVPTA-----------------------
FUG10003|RPS3        TAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKEEILPTTPISEQKGAKPEVPVMPQGAPVPTA---------------------
DAN10003|Rps3        TAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKEEVLPTTPVSEQKGAKPEVPVMPQGTPVPTA---------------------
MED10003|Rps3        TAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKEESLPTAPISEQKGAKPEVPVMPQGAPVPTA---------------------
CIO10003|RPS3        TAVRHVLLRQGVLGIKVKIMLPWDPQGKIGPKKPLPDNVNIVEPKDEEAITGPRSESKVTKPMPDPMPAAPQQAAMPPMQQVPPQQTMPPM------
DRO10003|RpS3        TATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL----------------------
MOS10003|Rps3        TATRHVLLRQGVLGIKVKIMLPWDPNGKIGPKKPLPDNVSVVEPKDEIMYSSPRSEPKFKVPEPLVEAKEHVVEA----------------------
BEE10003|Rps3        TATRHVLLRQGVLGIKVKIMLPYDPHGKTGPKKPLPDSVSIVEPKDEVFPSQPTSEVKASKDLPQPIPLAV--------------------------
CEL10003|rps-3       QAVRHVQLRQGVIGIKVKIMLPYDPRGQNGPRNALPDHVQIVEPQEEVLPKEPHSQHKEEKKDVQVPAAQPVAPVQ---------------------
BMA10003|RPS3        QAVRHVQLRQGVLGIKVKIMLPHDPKGNMGPRIALPDQIHIQEPNEAPNPLHPESEHKQEKKDLLQPMPGQMPQIPPY-------------------
STE10003|RPS3        TAVRHVYLRQGVLGIKVKIMLPWDPTGKTGPKKPLPDQVSIVEPKDEVVPAQPTSEHKGGKQEPSQPVPSL--------------------------
MBR10003|RPS3        TAVRHVPMRQGMIGIKVKIMLPHDPSGKTGPKAPLPDAITILEAKEEDIPDEPKSISHVAPVAAAQPVQATA-------------------------
NEU10003|Rps3        SATRHVLLRQGVLGIKVKIMRGSDPEGKSGPQKSLPDAVTIIEPKEEQPVTQPISQDYGAKAAQVQAAAEAARQEEQAGEEEAAAPAAEE-------
GRI10003|Rps3        SATRHVLLRQGVLGIKVKIMRGSDPEGKAGPQKSLPDAVTILEPKEEQPVVQPVSQDYGAKAAQVQAAAEAARQAEQGEGEEQEPAAEQ--------
GRA10003|Rps3        HATRHVLLRQGVLGIKVKIMRGSDPEGKAGPQKTLPDAVTIIEPKEEQAVLQPVSQDYGAKAAQAAQAAQDARVAEEEGGEEVQAVEQ---------
STA10003|Rps3        EATRHVLLRQGVLGIKVKIMRGSDPEGKAGPSKTLPDSVTIIEPKEEQPVVQPMSQDYGAKAIAAQQAAEQARQAEQGEGEAPAEGGEGYSEEQ---
YAR10003|Rps3        TATRHVLLRQGVLGVKVKIMRDPATSKKPGVPKSLPDAVTIFEPKEDAVVAEPMVKSYVVKTEVAAPAAAEPVEA----------------------
POM10004|RPS3        SATRHVLLRQGVLGVKVKIMLP---EPKTRQKKSLPDIVVVLDPKEEEPITKPYTVINQPVEAAAAAGQEVVAEQETAVAY----------------
YST10004|RPS3        TATRHVLMRQGVLGIKVKIMRDPAKSRTG--PKALPDAVTIIEPKEEEPILAPSVKDYRPAEETEAQAEPVEA------------------------
CIN10003|Rps3        YAVRHVLLRQGVLGIKVKIMKGYDREGQLGPRKPLPDSVQIFEPPVDKIISEPLSEQRELPAVAVAPAAEEAYAPPQEQPPQEAYAEQF--------
NEA10003|Rps3        YAVRHVLLRQGVLGIKVKIMKPSDPAGRQGPAKNLPDDVQITEPKAEGVIEIRSDHKNPPVQAIPPAAAPAPEAQAAEAQY----------------
MAY10003|Rps3        EAVRHVLMKQGVLGIKVKIMQGWDPEGRAGKPFPLPDAVTILEPKEEAPISAPVSESRNAPAEVAAPAAPAAPAAEAQPEAAF--------------
RHI10010|Rps3        TAVRHVDLRQGVLGIKVKIMLDNDPTGRNGPKQTLPDIVTILEPKDEAPITEPSAQDFRPAAVEPVEAH----------------------------
RHI10011|Rps3-2      TAVRHVDLRQGVLGIKVKIMLDNDPTGRNGPKQTLPDIVTILEPKDEAPITEPSAQDFRPAAVEPVEAH----------------------------
RHI10012|Rps3-3      TAVRHVDLRQGVLGIKVKIMLDNDPTGRNGPKQTLPDIVTILEPKDEAPITEPSAQDFRPAPAAVEPVQA---------------------------
RHI10013|Rps3-4      TAVRHVDLRQGVLGIKVKIMLDNDPTGRNGPKQTLPDIVTILEPKDEAPITEPSAQDFRPAAAPVEAVDAN--------------------------
ARA10007|RPS3A       AAVRHVLLRQGVLGIKVKIMLDWDPTGKSGPKTPLPDVVIIHAPKDDVVYSAPAQAAAPVTLVQEAPLTTVDYPEMIPPVA----------------
ARA10008|RPS3B       SAVRHVLLRQGVLGIKVKVMLDWDPKGISGPKTPLPDVVIIHSPKEEEAIYAPAQVAAPAALVADAPLTAVDYPAMIPVA-----------------
ARA10009|RPS3C       AAVRHVLLRQGVLGLKVKIMLDWDPKGKQGPMTPLPDVVIIHTPKEDDVYIAPAQVVTQAAFVPEAPLTTTDYPAMPVA------------------
RIC10008|RPS3B       SAVRHVLLRQGVLGIKVKIMLDWDPKGKVGPTTPLPDLVTIHAPKEEEELRPPVLIAEA--------------------------------------
RIC10009|RPS3A       SAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPMTPLPDLVTIHAPKDEDEFSKPLTAEIPVAA-----------------------------------
GMA10008|LOC10080870 SAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEEEEYNRPPAVLANDIEVVPVA------------------------------
GMA10009|LOC10079504 SAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEEEEYARPAAVLATNIEVPVAS------------------------------
GMA10010|LOC10079558 SAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHTPKEEEEYARPAAVLATDIEVPVA-------------------------------
GMA10011|LOC10080074 SAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHSPKEEEEYIRPAPVLAANNDIEVPVPVA---------------------------
GMA10012|LOC10079915 SAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHSPKEEEEYIQPAPVLAAN-DIEVPVA-----------------------------
GMA10013|LOC10049973 SAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDLVTIHSPKEEEEYIQPAPVLAAN-DIEVPVA-----------------------------
POP10003|RPS3        AAVRHVLLRQGVLGIKVKIMLDWDPKGKVGPMTPLPDLVTIHPPKEEEEYVAP-PVMTTNIEIPVALA-----------------------------
CRE10003|RPS3        GAVRHVLLRQGVLGIKVKIMKEWDPTGKRGPRTPLPDVVKVLEPKEEEVYQEKPYIGKEEL------------------------------------
VOL10003|RPS3        AAVRHVLLRQGVLGIKVKIMKDWDPTGKRGPRTPLPDVVKVLEPKEEEIFQEKPHIGKEDM------------------------------------
HEM10003|rps3        KATRHCFLRQGVIGIKISIMLPWDPAGVRGPKKPLPDVVTVLENKINF-------------------------------------------------
PTR10003|RPS3        SAVRHVLMRQGVIGIKVSIMLPQDPKGQMGPKIPLDDVVTILEPKEEPSP-----AQLMAQQAAAAAAYQAAAPPMMEAPVDPAGMAPVDPAIQAGF
TPS10003|Rps3        VAVRHVLMRQGVIGIKVAIMLPHDPKGVQGPKIPLDDVVTILEPKEEPSPESILQAQQAAEAAAAAAAQAALQQQLLAQQQAEMAAAGGAPAVDAGF
CYA10003|RPS3        RAVRHVLLRQGVLGIKVKIMLPHDPTGRQGPRKPLPDSIVILEPKEEDTLGKVVATHTTYGPAAMPAAPVGVAPGVMGGAPVIGVGAARP-------
DIC10003|RPS3        FACRHVLLRQGTLGVKVAIMLPYDETRKIHGACNIPQPDVVVIRDA---------------------------------------------------
PLA10003|RPS3        TATRSAQLKQGVLGIKVKIMLPTAIDTRTGLTSILPDNISVLEPKTDTVDL----------------------------------------------
TGO10003|RPS3        QAIRSVQLRQGVLGVRVKIMLPHDPEGKRGPANPLPDTIIVMDPKPEIPVVQPEEMDEGVLGPM---------------------------------
GIA10003|Rps3        EATRHIKMRQGVIGVKVRIYNPN------IRGAVMPDKIEIGAFSRQK-------------------------------------------------