CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10033|RPS30       --MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEK
DOG10032|Rps30       --MQLFVRAQELHTLEVTGQETVAQIKAHVASLEGIAPEDQVLLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEK
MUS10032|Rps30_Fau   --MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEK
RAT10032|Rps30       --MQLFVRAQELHTLEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEK
FUG10033|RPS30       --MQLFLRAQNTHTLEVTGQETVGEIKAHAESLEGLLAEDQVLLLNGCPLEDGVSLASCGVSEHCTLEVVGRLLGGKVHGSLARAGKVRGQTPKVDKQEK
DAN10032|Rps30       --MQLFVRGQSLHSVQLNGSETVAHIKAQIEALEGLACDDQIISLSGIPLEDDALICQSGIEEFNTLEVSSRLLGGKVHGSLARAGKVRGQTPKVDKQEK
MED10032|Rps30       --MQLFLRAQNTHTLEVTGEETVGQIKAHVQTLEGILVEDQVLMLTGCPLEDDASLVSCGVSEFCTLEVAGRLLGGKVHGSLARAGKVRGQTPKVDKQEK
CIO10032|RPS30       --MQIFLKTNELHCVQVDSGDLVSNLKAQINAIEGIATEDQVLSYNGITLDDDLSLEAAGLNDLSTVQVLGRVLGGKVHGSLARAGKVKGQTPKVEAQEK
DRO10041|RpS30       -MQLFVRGLETIEALEVSQDATIAGVKNQLAQIHGFNAEEFSLDCEGITLANETPVTALSSFELDLNIP---MLGGKVHGSLARAGKVKGQTPKVEKQEK
MOS10032|Rps30       -MQLHVRGLN-THVLDVQPGDSISHVKAVLAGLESVDAQELNLYCEGVPLGEDVTVSQLTSVELDLTVS---LLGGKVHGSLARAGKVKGQTPKVEKKEK
BEE10033|Rps30       -MQLHIRGER-TTVVESHENETIADLKKKIVELKCAANIDFNLYCSGLLLQNDSLVGDLTSNVLELTVS---LPGGKVHGSLARAGKVKAQTPKVEKQEK
CEL10031|rps-30      MQIFLLGLDNTTHTLDVDASTTLSAIKGVIGAGEEFSISYGSKVLSEELTLGECQIESLS--TLSVNGR---LLGGKVHGSLARAGKVRAQTPKVDKQDK
BMA10032|RPS30       MQIFVRGIDDGVRTICISETSTVAELKALLCADGALLTCGAEILDDDKAPLMNFGICDKA--NIDVSFR---LLGGKVHGSLARAGKVRAQTPKVEKQEK
STE10032|RPS30       --MQLFVRGQNLHTLNVEGCDSVLGIKQELALRDGIPVEDQVLLYAGRPLEDGMSLEECELFDQVTLDLGVRLLGGKVHGSLARAGKVKSQTPKVDAQEK
MBR10032|RPS30       --MQLFVRAQGTHVFEADASSTVDDVKAFVAAAEGIAVEDQYLVSAGRPLEYGL----LDVSPLSTIEVGVRMLGGKVHGSLARAGKVKGQTPKVEKQEK
NEU10032|Rps30-1     --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEKQEK
NEU10033|Rps30-2     --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEPQEK
GRI10032|Rps30       --------------------------------------------------------------------------MGKQHGSLARAGKVKSQTPKVEPQEK
GRA10033|Rps30       --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEKQEK
STA10032|Rps30       --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEPQEK
YAR10033|Rps30       --------------------------------------------------------------------------MGKQHGSIARAGKVKSQTPKVEKQEK
POM10054|RPS30-1     --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEKQEK
POM10055|RPS30-2     --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEKQEK
YST10055|RPS30A      --------------------------------------------------------------------------MAKVHGSLARAGKVKSQTPKVEKTEK
YST10056|RPS30B      --------------------------------------------------------------------------MAKVHGSLARAGKVKSQTPKVEKTEK
CIN10032|Rps30       --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEPQEK
NEA10032|Rps30       --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEPQEK
MAY10032|Rps30       --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVEKQEK
RHI10121|Rps30       --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVAKQEK
RHI10122|Rps30-2     --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVAKQEK
RHI10123|Rps30-3     --------------------------------------------------------------------------MGKVHGSLARAGKVKSQTPKVAKQEK
RHI10124|Rps30-4     --------------------------------------------------------------------------MGKVHSSLACAGKVKSQTPKVAKQEK
ARA10090|RPS30A      --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
ARA10091|RPS30B      --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
ARA10092|RPS30C      --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
RIC10105|RPS30B      --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
GMA10163|LOC10081360 --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
GMA10164|LOC10080385 --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
GMA10165|LOC10030627 --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
POP10032|RPS30       --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVAKQDK
CRE10032|RPS30       --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVPKQEK
VOL10035|RPS30       --------------------------------------------------------------------------MGKVHGSLARAGKVRGQTPKVPKQEK
HEM10029|rps30       --------------------------------------------------------------------------MGKVHGSLSRAGKVKGQTPKVEKKER
PTR10034|RPS30       --------------------------------------------------------------------------MGKVHGSLARAGKVKGQTPKVEAQED
TPS10032|Rps30       --------------------------------------------------------------------------MGKVHGSLARAGKVKGQTPKVEAQEK
CYA10033|RPS30       --------------------------------------------------------------------------MGKVHGSLARAGKVKAQTPKVAKQEK
DIC10032|RPS30       --------------------------------------------------------------------------MGKVHGGLNRAGKVRNATPKKDKEEK
PLA10036|RPS30       --------------------------------------------------------------------------MGKVHGSLARAGKVKNQTPKVPKLDK
TGO10032|RPS30       --------------------------------------------------------------------------MGKVHGSLARAGKVKNQTPKVAKKEK
GIA10032|Rps30       --------------------------------------------------------------------------MARAHGGLTSAGKVRKCTPKKEKKEK
SUL10051|STS139      ---------------------------------------------------------------------------MPSHGSLTKAGKVRNATPKMPKKER


HUM10033|RPS30       KK-KKTGRAKRRM-QYNRRFVNVVPT-FGKKKGPNANS-------
DOG10032|Rps30       KK-KKTGRAKRRM-QYNRRFVNVVPT-FGKKKGPNANS-------
MUS10032|Rps30_Fau   KK-KKTGRAKRRM-QYNRRFVNVVPT-FGKKKGPNANS-------
RAT10032|Rps30       KK-KKTGRAKRRM-QYNRRFVNVVPT-FGKKKGPNANS-------
FUG10033|RPS30       KK-KKTGRAKRRI-QYNRRFVNVVPT-FGKKKGPNANS-------
DAN10032|Rps30       RK-KRTGRAKRRI-QYNRRFVNVVPT-FGKKKGPNANS-------
MED10032|Rps30       KK-KKTGRAKRRI-QYNRRFVNVVPT-FGKKKGPNANS-------
CIO10032|RPS30       KK-KKTGRAKRRM-QYNRRFVNVV-ATFGRRRGPNANS-------
DRO10041|RpS30       KK-KKTGRAKRRI-QYNRRFVNFVQG-FGRRRGPNANST------
MOS10032|Rps30       KK-KKTGRAKRRI-QYNRRFSSVVQA-YGRRRGPNANSA------
BEE10033|Rps30       SK-KKTGRAKRRI-QYNRRFVNVVQT-YSRRRGPNANSNS-----
CEL10031|rps-30      KK-KKRGRAFRRV-QYTRRYVNVASG-PGKKRGPNSNS-------
BMA10032|RPS30       KK-KKTGRAARRI-QYNRRFVNIAVSGIGRKRGPNSNAA------
STE10032|RPS30       KK-KKTGRAKRRM-QYNRRFVNVV-QTFGRRRGPNSNAP------
MBR10032|RPS30       KK-VKTGRAKRRM-QYNKRVVNVVTGLG-KKRGPNSQSQ------
NEU10032|Rps30-1     KK-TPKGRAKKRL-TYTRRFVNVTMT-GGKRKMNPNPGS------
NEU10033|Rps30-2     PK-TPKGRAHKRE-IYTRRFVNVVTGPGGKRKMNANPSA------
GRI10032|Rps30       PK-RPKGRAHKRE-QYVRRFVNVTLAPGGKRKMNPNPTA------
GRA10033|Rps30       SK-VPKGRALKRL-KYTRRFVNVTLT-GGKRKMNPNPGS------
STA10032|Rps30       KK-TPKGRAKKRL-TYTRRFVNVTMT-GGKRKMNPNPTS------
YAR10033|Rps30       PK-APVGRAKKRL-LYTRRFINVT-LVNGKRKMNQNSA-------
POM10054|RPS30-1     PK-QPKGRAYKRL-LYVRRFVNVTNMVGGKRRMNPSS--------
POM10055|RPS30-2     PK-QPKGRAYKRL-LYVRRFVNVTNMVGGKRRMNPSS--------
YST10055|RPS30A      PK-KPKGRAYKRL-LYTRRFVNVT-LVNGKRRMNPGPSVQ-----
YST10056|RPS30B      PK-KPKGRAYKRL-LYTRRFVNVT-LVNGKRRMNPGPSVQ-----
CIN10032|Rps30       KK-TPKGRAKKRL-LYNRRFVNVTTLPGGKRRMNPNPEK------
NEA10032|Rps30       KK-VPKGRAQKRL-QYTRRFVNVTVAPGGKRRMNQQPVGKSG---
MAY10032|Rps30       AK-QPKGRAKKRL-LYTRRFVNVVAGPGGKRRMNPNGEK------
RHI10121|Rps30       KK-AKTGRAKKRQ-VYNRRFVNVTTQVGGKRRMNPAPTAGP----
RHI10122|Rps30-2     KK-AKTGRAKKRQ-VYNRRFVNVTTQVGGKRRMNPAPTAGP----
RHI10123|Rps30-3     KK-AKTGRAKKRQ-VYNRRFVNVTTQVGGKRRMNPAPTAGP----
RHI10124|Rps30-4     KK-AKTGRVKKRQPCFRRRLVNVTTLVGGKRRMNPAPTVGP----
ARA10090|RPS30A      KK-KPRGRAHKRL-QHNRRFVTAVVG-FGKKRGPNSSEK------
ARA10091|RPS30B      KK-KPRGRAHKRL-QHNRRFVTAVVG-FGKKRGPNSSEK------
ARA10092|RPS30C      KK-KPRGRAHKRL-QHNRRFVTAVVG-FGKKRGPNSSEK------
RIC10105|RPS30B      KK-KPRGRAHKRM-QYNRRFVTAVVG-FGKKRGPNSSEK------
GMA10163|LOC10081360 KK-KPRGRAHKRM-QYNRRFVTAVVG-FGKKRGPNSSEK------
GMA10164|LOC10080385 KK-KPRGRAHKRM-QYNRRFVTAVVG-FGKKRGPNSSEK------
GMA10165|LOC10030627 KK-KPRGRAHKRM-QYNRRFVTAVVG-FGKKRGPNSSEK------
POP10032|RPS30       KK-KPRGRAHKRM-QYNRRFVTAVVG-FGKKRGPNSSEK------
CRE10032|RPS30       KK-RPRGRAMKRM-KYNRRFVNVVVG-FGKKRGPNSNPA------
VOL10035|RPS30       KK-RPRGRAMKRM-KYNRRFVNVVVG-FGKKRGPNSNPA------
HEM10029|rps30       KK-QPKGRALQRL-KFKKKFLNSFGDSKKQKK-------------
PTR10034|RPS30       KKKQPRGRAKKRL-QYNRRYVNVVTGMGGKRVGPNSNADKMK---
TPS10032|Rps30       TK-QPRGRAKKRM-QYNRRYVNVVTGMGGKKVGPNSNADKMK---
CYA10033|RPS30       PK-KPRGRANLRA-KYNRRFVNVATG-PGRKRGPNAQTL------
DIC10032|RPS30       RK-PKVGRAKKRM-IFNRRNVAAVAG-FGKKKGYNTQNVPTVA--
PLA10036|RPS30       KK-RLTGRAKKRQ-LYNRRFS----DNGGRKKGPNSKA-------
TGO10032|RPS30       KK-PPTGRAKKRQ-QFNRRFT---TS-VGRKRGPNAQTQ------
GIA10032|Rps30       PR-PPRGRAYKRL-LYNKNFVDDTLIHNGRRLGPNNLLIRQKLGF
SUL10051|STS139      HK--EVPRVRNRI-EYEKRVVKTRQS----KQAVAAR--------