CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10004|RPS3A       MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNI----RNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQND---EVAFRKFKLITEDVQG
DOG10004|Rps3a       MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNI----RNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQND---EVAFRKFKLITEDVQG
MUS10004|Rps3a       MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNI----RNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQND---EVAFRKFKLITEDVQG
RAT10004|Rps3a       MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNI----RNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQND---EVAFRKFKLITEDVQG
CHK10004|Rps3a       MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNI----RNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQND---EVAFRKFKLITEDVQG
FUG10004|RPS3A       MAVGKNKRLTKGGKKGAKKKIVDPFSKKDWYDVKAPAMFNI----RNLGKTLVTRTQGTRIASDGLKGRVYEVSLADLQND---EVAFRKFKLIAEDVQG
DAN10004|Rps3a       MAVGKNKRLTKGGKKGAKKKIVDPFSKKDWYDVKAPAMFNI----RNLGKTLVTRTQGTRIASDGLKGRVFEVSLADLQND---EVAFRKFKLVTEDVQG
MED10004|Rps3a       MAVGKNKRLTKGGKKGAKKKIVDPFSKKDWYDVKAPAMFNI----RNLGKTLVTRTQGTKIASDGLKGRVFEVSLADLQND---EVAFRKFKLITEDVQG
CIO10004|RPS3A       MAVGKNKRLTKGGKKGGKKKIVDPFSKKDWYDVKAPAVFKN----RQIGKTLVSRTVGTKIAADGLKGRVFECNQADLHGD---ESTYRKMKLIVEDVQG
DRO10004|RpS3A       MAVGKNKGLSKGGKKGGKKKVVDPFSRKDWYDVKAPNMFQT----RQIGKTLVNRTQGQRIASDYLKGRVFEVSLADLQKDIDPERSFRKFRLIAEDVQD
MOS10004|Rps3a       MAVGKNKGVSKGGKKGSKKKVVDPFTRKDWYDVKAPNMFKN----RQVGKTLVNRTQGTKIASDGLKGRVFEVSLADLQNEPDAERSFRKFKLVAESVNG
BEE10004|Rps3a       MAVGKNKGLSKGGKKGVKKKIVDPFTRKDWYDVKAPSMFTN----RHVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDGDAERSFRKFRLIAEDVQH
CEL10004|rps-1       --MAVGKNNNKMGKKGGKKKAVDPFSRKEWYDIKAPNMFNT----RQVGKTLINRTQGTKIASEGLKGRVFEVSLGDLNN---SEADFRKFKLIAEDVQG
BMA10004|RPS3A       --MAVGKNK-KMGKKGAKKKVVDPFTRKEWYDIKAPSMFNV----QHIGKTLVNRTQGTKIASEGLKGRVYEVSLGDLNN---AESEFRKMRLICEDVQG
STE10004|RPS3A       MAVGKNKRLTKG-KKGVKKKIVDPFTKKDWYDVKAPSMFNI----RQIGKTVVTRTAGTKIASDGLKGRVFEVSLADLQND---EIAFRKFKLMCEEVQG
MBR10004|RPS3A       MAVGKNKKLMKG-KKGGKKKVVDVFTKKEWYDVKAPSYFKK----RQVGKTPVNRTAGTKLSADGLRGRVYEMSLADLNDD---ESTFRKVKLQVEEIQG
NEU10004|Rps3a       MAVGKNKRLSKGKKGLKKK-TQDPFARKDWYGIKAPAPFNV----RDVGKTLVNRTTGLKNANDALKGRIFEVSLADLQKD--EDHSFRKVKLRVDEIQG
GRI10004|Rps3a       MAVGKNKRLSKGKKGLKKK-TQDPFARKDWYGIKAPAPFNI----RDVGKTLVNRSSGMKNANDALKGRIFEVSLADLQKD--EDHAFRKIKLRVDEVQG
GRA10004|Rps3a       MAVGKNKRLSKGKKGLKKK-TVDPFSRKDWYSIKAPNPFNV----RDVGKTLVNRTTGLKNANDALKGRILEVSLADLQKD--EDHSFRKVRLRVDEVQG
STA10004|Rps3a       MAVGKNKRLSKGKKGLKKK-TDT-FAKKDWYNVKAPGTFAI----RDVGKTLVNRTTGLKNANDALKGRIFEVSLADLQKD--EDHAFRKVKLRVDEVQG
YAR10004|Rps3a       MAQGKNKRLSKGKKGIKKR-VVDPFTKKDWYNIKAPSTFEN----RDVGKTLVNRSTGLRLANDYLKGRVLEVSLADLQGQ--EDHSFKKVKLRVDEVQG
POM10005|RPS3A-1     MAVGKNKRLSKGKKGIKKR-VVDPFSRKDWYDIKAPAFFEV----KNVGKTLVNRTAGLKNANDSLKGRILEVSLADLQKD--EEHSFRKVKLRVEDIQG
POM10006|RPS3A-2     MAVGKNKRLSKGKKGIKKR-VVDPFSRKEWYDIKAPAFFEV----KNVGKTLVNRTAGLKNANDSLKGRILEVSLADLQKD--EEHAFRKVKLRVEDIQG
YST10005|RPS1A       MAVGKNKRLSKGKKGQKKR-VVDPFTRKEWFDIKAPSTFEN----RNVGKTLVNKSTGLKSASDALKGRVVEVCLADLQGS--EDHSFRKIKLRVDEVQG
YST10006|RPS1B       MAVGKNKRLSRGKKGLKKK-VVDPFTRKEWFDIKAPSTFEN----RNVGKTLVNKSTGLKNASDALKGRVVEVCLADLQGS--EDHSFRKVKLRVDEVQG
CIN10004|Rps3a       MAVGKNKRLSKGKKGLKKK-VVDPFTRKDWYDIKAPSIFET----RNVGKTLVNRSQGLKNANDSLRGRIIEVSLADLNKD--EEQSFRKIKLRVDEIQG
NEA10004|Rps3a       MAVGKNKRLSKGKKGIKKK-VVDPFSRKEWYDIKAPSFFEN----RNAGKTLVNRTQGLKNANDSLKGRVLELSLADLNND--QEQSFRKIKLRVEEVAG
MAY10004|Rps3a       MAVGKNKKLSKGK-GQKKR-AVDPFTRKDWYDIKAPTFFEN----RNVGKTFVNRSQGLKNADDSLKGRIVEASLADLNKD--DEQAYRKFKLKVDGIQG
RHI10014|Rps3a       MAVGKNKRLSKGKKGLKKK-VVDPFTRKDWYDIKAPSMFEV----RQVGKTLVNRTQGLRNANDSLNGRVVEMSLGDLSKD--ESRSFRQIKLKVDEIQG
RHI10015|Rps3a-3     MAVGKNKRLSKGKKGLKKK-VVDPFTRKDWYDIKAPSMFEV----RQVGKTLVNRTQGLRNANDSLNGRVVEMSLGDLSKD--ESRSFRKIKLKVDEIQG
RHI10016|Rps3a-4     MAVGKNKRLSKGKKGLKKK-VVDPFTRKDWYDIKAPSMFEV----RQVGKTLVNRTQGLRNANDSLNGRVVEMSLGDLSKD--ESRSFRKIKLKVDEIQG
RHI10017|Rps3a-2     MAVGKNKRLSKGKKGLKKK-VVDPFTRKDWYDIKAPSMFEV----RQVGKTLVNRTQGLRNANDSLNGRVVEMSLGDLSKD--ESRSFRKIKLKVDEIQG
RHI10018|Rps3a-5     MAVGKNKRLSKGKKGLKKK-VVDPFTRKDWYDIKAPSMFEV----RQVGKTLVNRTQGLRNANDSLNGRVVEMSLGDLSKD--ESRSFRKIKLKVDEIQG
ARA10010|RPS3Aa      MAVGKNKRISKGRKGGKKK-AVDPFSKKDWYDVKAPSIFTH----RNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGD--EDNAYRKIRLRAEDVQG
ARA10011|RPS3Ab      MAVGKNKRISKGRKGGKKK-AVDPFSKKDWYDVKAPGSFTN----RNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQND--EDNAYRKIRLRAEDVQG
RIC10010|RPS3Aa      MAVGKNKRISKGKKGSKKK-TVDPFAKKDWYDIKAPSVFNV----RNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQND--EDQAYRKIRLRAEDVQG
GMA10014|LOC10080551 MAVGKNKRISKGKKGGKKK-AADPFAKKDWYDIKAPSVFQV----KNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGD--EDHAFKKIRLRAEDVQG
GMA10015|LOC10078157 MAVGKNKRISKAKKVGKKK-AADPFTKKDWYDIKAPSVFQV----KNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGD--EDHAFKKIRLRAEDVQG
GMA10017|LOC10081327 MAVGKNKRISKGKKGGKKK-AADPFAKKDWYDIKAPSLFQV----KNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGD--EDHAFKKIRLRAEDVQG
GMA10018|LOC10081873 MAVGKNKRISKGKKGGKKK-AADPFAKKDWYDIKAPSVFQV----KNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGD--EDHAFKKIRLRAEDVQG
GMA10019|LOC10080874 MAVGKNKRISKGKKGGKKK-AADPFAKKDWYDIKAPSLFQV----KNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGD--EDHSFKKIRLRAEDVQG
POP10004|RPS3A       MAVGKNKRISKGKKGGKKK-AADPFSKKDWYDIKAPSVFSV----KNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGD--EDNAYRKIRLRAEDVQG
CRE10004|RPS3A       MAVGKNKRISKGKKGGKKK-ASDPFAKKDWYDIKAPTMFTV----RNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKN--EDDAFRKMRLRVEDVQG
VOL10004|RPS3A       MAVGKNKRISKGKKGGKKK-ASDPFAKKDWYDIKAPTVFTV----RNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKN--EDDAFRKMRLRVEDVQG
HEM10004|rps3A       MTLYKNKRLSKTGKEGRKK-ISNVFEKKEWIELKTPSLFGE----KIFGNTIVNKRTNANKSTEILTNRIYQISLGDLNNK--ESLSFRKIKLKGSEVKN
PTR10004|RPS3A       MAVGKNKRLTKSKKGSRKK-AVDPFLKKEWYKFVAPSLFAT----KDAGRTLITKTQGTKIASEGLKGRVIEMSLADLNKN--EALAYRKIKLCVEDVQG
TPS10004|Rps3a       MAIGKNKRLTKSKKGGKKK-AVDPFLKKEWYKLIAPSIFAE----KNCGKTIITKTQGTKIASEYLKGRVIELSLADLNNN--EAMSYRKVKLCIEDVQG
CYA10004|RPS3A       MAQGKNKRLSKGKKGSKKK-ILDPYSRKEWYDVKAPSYFSV----RQAGKTIVSKTSGTRIASESLKGRVFEISLADLQKD--EDLAYRKIKLRCEDVQG
DIC10004|RPS3A       ----MADKKKKGSKKGGKK--VDPFTRKEWYVVRAPTQFFKSPADNKVGFTPVNRTQGTKLASDGLKGRVYEVSLADMKDD--ESQVFRKIKLRAEEVEG
PLA10004|RPS3A       MAVGKNKRTSKGKKGGKKK-VTDVFTKKEWYDLKAPKMFLV----RNFGKTLVTKTIGKKLATDSLKGRIYEVNLADLNND--EDQAHKKIKLSCDHIIN
TGO10004|RPS3A       MAIGKNKRMSKGKKGGKKK-IGDPFLKKEWYDLKAPTLFNV----RNFGKTLVTKSQGTKLAVDGLRGRVYEVNLADLNND--EDQGFRKIKLCCEDIQG
GIA10004|Rps3a       MAIGGNKTGKKKITQRKNP---DPYLKKEWYPVIAPAHFKS----RHIGQTPVTKTAGLRVATDVINHRVYEVNLGDLNPGAEDLNGNTKFYLQTQLVSD
HAL10033|VNG0787G    ---------------MSERSVSKQDQEKRWYTVLAPEEFDR----AELGETLAEE-------PDQVYDRTIQAALSDVRDG---GDNNIKLTFQIDDVGS
MET10002|MJ0980      -----MATARTARSRRKVRKVRDKWKEKVWYEIYATPEFGG----VFIGYTPAND-------PSLVLGRVAETSLRDLTGD--PTKHMHRVYFKIFGVTG
PYR10036|PH0060      ----------MMAAKKRVTAAKDKWKLKQWYIIYAPDFFGG----VEVGLTPADD-------PEKVMNRVVEVTLKDITGD--FTKGHVKLYFQVYDVKG
SUL10038|ST0453      --------------MSSKTAIKDKWKLKKWFTIVAPKTFGE----VVLGTTPAFD-------ANQALNRKVETTLYDLTGD--YSLVYVHLYFRVIGVEG


HUM10004|RPS3A       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
DOG10004|Rps3a       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
MUS10004|Rps3a       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
RAT10004|Rps3a       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
CHK10004|Rps3a       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
FUG10004|RPS3A       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKRRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
DAN10004|Rps3a       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRTNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
MED10004|Rps3a       KNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQVRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIP---
CIO10004|RPS3A       KHCLTNFHGMSLTRDKLCSMVKKWQTLIEASCDVSTTDGYKVRMFCIGFTHRRSNQIKKTSYAQHMQVINIRAKMIEIMTREVNLGNLRELVNKLIP---
DRO10004|RpS3A       RNVLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCYAQQSQVRKIRARMTDIITNEVSGADLKQLVNKLAL---
MOS10004|Rps3a       RDVLTNFHGMALTTDKLRSMVKKWQTLIECSVDVKTTDGFMLRVFCIGFTIKDSMSQRKTCYAQHSQIKNIRAKMTAIIKREITSTDLKGVVEKLLP---
BEE10004|Rps3a       RNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNKDQLSTRKTCYAQHAQVKKIRQKMVDTITNDVTKSDLKGVVSKLLP---
CEL10004|rps-1       KNVLTNFHAMSMTHDKLCSIVKKWHTLIEANTAVKTTDGYTLRVFVIAFTKKSVNQVKKTSYTKTSKIRKIRSEMIGCIEKEVTGCDLKEVVSKLIP---
BMA10004|RPS3A       RTCLTNFHGMRLTRDKLCSIVKKWHTLIEANVAVKTSDGYLLRLFCIGFTKKNARQLKKTSYAKSSKIRQIRAKMVEYMQKEVQGSDLKDVCHKLVP---
STE10004|RPS3A       RNCLTNFHGMNMTTDKLRSLVKKWQTLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVSTNDLKEVVNKLIP---
MBR10004|RPS3A       TECLTNFHGMSLTTDKLRSLVKKWRSLIEAFVDVKTNDGYVLRIFSIGFTKKQANSDRKTCYAQSAQKRALRAKMVEIMQREAT-CDLKEFVSKLMP---
NEU10004|Rps3a       KNCLTNFHGLDFTSDKLRSLVRKWQTLIEANITVKTTDDYLLRLFAIAFTKRRPNQVKKTTYAASSQIRAIRRKMTEIIQREASSCTLTQLTSKLIP---
GRI10004|Rps3a       KNCLTNFHGLDFTSDKLRSLVRKWQSLIEANVTVKTTDDYLLRLFAIAFTKRRPNQIKKTTYAASSQIRAIRRKMTEIIQREASTCTLQQLTNKLIP---
GRA10004|Rps3a       KNCLTAFHGLDFTSDKLRSLVRKWQTLIEANVTVKTTDDYLIRLFAIGFTKRRGNQVKKTTYAASSQIRAIRRKMTDIIQREASSCTLTQLTSKLIP---
STA10004|Rps3a       KNCLTNFHGLDFTSDKLRSLVRKWQTLIEANVVVKTTDDYLLRLFAIGFTKRRPNQIKKTTYAASSQIRAIRKKMVEIMTRDASSCTLAQLTQKLIP---
YAR10004|Rps3a       KNLLTNFHGFDFTSDKLRSLVRKWQTLIEANVTVKTSDDYFLRLFVIGFTKRQANQVKKTTYAQTSQINQIRKKMTDIVVREASNVTLAQLTAKLIP---
POM10005|RPS3A-1     KSCLTSFNGFDMTSDKLRSLVRKWQSTIEANQTIKTTDGYLCRIFVIGFTSRRVNQVKKTTYAQSSQIRAIHQKMFQVIQNQANGCSMKELVQKLIP---
POM10006|RPS3A-2     KSCLTSFNGLSITSDKLRSLVRKWQTTIEADQTIKTTDGYLCRVFVIGFTRRRANQVKKTTYAQSSQIRAIRQKMFQVIQNQTSSCSMRELVQKLIP---
YST10005|RPS1A       KNLLTNFHGMDFTTDKLRSMVRKWQTLIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVISEILTKEVQGSTLAQLTSKLIP---
YST10006|RPS1B       KNLLTNFHGMDFTTDKLRSMVRKWQTLIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVISEILTREVQNSTLAQLTSKLIP---
CIN10004|Rps3a       RNCLTNFHGMDFTSDKLRSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPTQVKKTTYAQTAQVRELRKKMFEIITREATSCDLKELVQKFVP---
NEA10004|Rps3a       KSCLTSFYGMDFTTDKLRSIVRKWQSLVEAHVDVKTTDGYVLRLFAIGFTKRQSNQVKKTTYAQSSQLKEIRAKMVEIMRREAEGSDLKELVQKFVP---
MAY10004|Rps3a       RTCLTNFYGMDFTSDKLRSLVRKWQSLIEAHQDVKTTDGYLLRVFVIAFTKKRANQVKKNTYAKSSHIRAIRQKMFEIVQREANSCDLREFVAKLIP---
RHI10014|Rps3a       KNCLTNFNGMDMTTDKLRSMVKKWQSLIEAFVDIKTTDGYLVRLFAISFTARRRNQIKKTTYAQSSQIRQIRKKMFEIMTEEASACDLKELVAKVTSSAS
RHI10015|Rps3a-3     KNCLTNFNGMDMTTDKLRSMVKKWQSLIEAFVDIKTTDGYLVRLFAISFTARRRNQIKKTTYAQSSQIRQIRKKMFEIMTEEASACDLKELVAKVTSSAS
RHI10016|Rps3a-4     KNCLTNFNGMDMTTDKLRSMVKKWQSLIEAFVDIKTTDGYLVRLFAISFTARRRNQIKKTTYAQSSQIRQIRKKMFEIMTEEASACDLKELVAKVTSSAS
RHI10017|Rps3a-2     KNCLTNFNGMDMTTDKLRSMVKKWQSLIEAFVDIKTTDGYLVRLFAISFTARRRNQIKKTTYAQSSQIRQIRKKMFEIMTEEASACDLKELVAKVTSSAS
RHI10018|Rps3a-5     KNCLTNFNGMDMTTDKLRSMVKKWQSLIEAFVDIKTTDGYLVRLFAISFTARRRNQIKKTTYAQSSQIRQIRKKMFEIMTEEASACDLKELVAKVTSSAS
ARA10010|RPS3Aa      RNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRDIMVREASSCDLKDLVAKFIP---
ARA10011|RPS3Ab      RNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIP---
RIC10010|RPS3Aa      KNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEIMANQASSCDLKELVSKFIP---
GMA10014|LOC10080551 KNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMREIMVNQAAACDLKELVRKFIP---
GMA10015|LOC10078157 KNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVKQIRRKMTEIMVNQTTSCDLKEVVRKLIP---
GMA10017|LOC10081327 KNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMREIMTNQATSCDLKELVRKFIP---
GMA10018|LOC10081873 KNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMREIMTNQATACDLKELVRKFIP---
GMA10019|LOC10080874 KNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMREIMVNQATACDLKELVRKFIP---
POP10004|RPS3A       RNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTTYAQSSQIRQIRRKMREIMTAQAASCDLKELVRKFIP---
CRE10004|RPS3A       RNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQGQIKRTCYAQSAQIRQIRKKMMEIITREATSCDLKELVAKFIP---
VOL10004|RPS3A       RNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQGQIKRTCYAQSAQIRQIRKKMTEIITREATSCDLKDLVAKFIP---
HEM10004|rps3A       NTCETSFFGMDLTRDKLSSLVKKWQTTIETSIDIKTEDGFFLRIFCFVFSKRKKKQLKKTSYLTSSQIRAIRRKIIATLLKFSLENNLKSLIGKFLS---
PTR10004|RPS3A       YNCLTNFHGMDMTRDKLCSLIRKKQSIIEGSVDCRTTDGYTVRMFCIAFTRPQENQIKNTCYAKSAQIRAIRAKMVSVMSELGTKGDLKSLVKELIS---
TPS10004|Rps3a       FNCLLNFHGMDMTRDKLCSLIKKKQSIIEANVDCRTTDGYIVRMFCIAFTKKQDDQLKETCYAKSGKAKQIRAKMVNTMSTLAGKGDLKTLVKALIA---
CYA10004|RPS3A       RNCLTQFYGFDFTRDKLSSMMRKWQTTIEAHVDVKTLDDYVLRLFCIGFTKRRQGQIRKTSYCKKSQERAIRKKMVDIMVQETSKGTLRDFVANIIP---
DIC10004|RPS3A       RNVLTNFYGMDLTSDKLRSLIHKWSTLIECFVDVKTTDGYFLRVFAICFTKKGESQKKKTSYAKTSRVKAIRKKMVDILTETVSSNDLKTVVDYLIGVSL
PLA10004|RPS3A       RDCYTDFCGLSITRDKLCSLIRKGYTLIEGHTDVKTLDNYHLRMFCIAFTKKRQNQTKSTCYAQTSQIKKIRKKMVDIMTAEASKVLLKDLVKKFIP---
TGO10004|RPS3A       RNCLTDFHGMDMTRDKICSLVRKCHSLIEAFVDVTTLDGYTLRMFCIAFTKRRPEQVKSTCYAQTSQIRAIRKKMMTIMSAEASKCQLRDLVKKFIP---
GIA10004|Rps3a       GKCLTNFHGMDITRHKYGSLFRKGCDCIDVFMDIPTTDGYLLRVFVIAFTDRFRFQRRKNCHVKGRVIRMMRAGIYETLHNELGKVSIPVLVTKLSN---
HAL10033|VNG0787G    DSASTQFVQAELTRDYQRSLVRRGSSKVAVTVTVLTTDDYRVRIQPVAYTTKQADQ---------SQQHAIRRTMIDLVEEAGEERTFEALLNSIIEG--
MET10002|MJ0980      NKAIAQYYGHDTTREFMKSQIRRRRSRIDAILDVKTQDGHKIRTKAMVLTAYR---------ANTKQKSDIRKKMEEIIKAMAKEKTFPQYVQAMLFG--
PYR10036|PH0060      QNAYTKFKGMKLARSYIRSLVRRRTTRIDGIFNITTKDGYRLRVMAMAIAMRR---------IQTSQERAIRKIMQEIIYKKAEELNFKDFVLEAVNG--
SUL10038|ST0453      DRLLTRFAGHELSRDYIRSLVRRKSSKIDAITDVTTKDGYVLRVKGLALTTYR---------AHRSQKTEIRKIIWNILSTRASETTFDEFVQDIVFG--


HUM10004|RPS3A       -----------DSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSS---SGKATGDETGAKVERADG--YEPPVQESV
DOG10004|Rps3a       -----------DSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSS---SGKATGDETGAKVERADG--YEPPVQESV
MUS10004|Rps3a       -----------DSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGGS---SGKAAGDETGAKVERADG--YEPPVQESV
RAT10004|Rps3a       -----------DSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGGS---SGKTTGDETGAKVERADG--YEPPVQESV
CHK10004|Rps3a       -----------DSIGKDIEKACQSIYPLHDVYVRKVKMLKKPKFELGKLMELHGEGGG---AGKPSGDEAGAKVERADG--YEPPVQESV
FUG10004|RPS3A       -----------DSIGKDIEKACQSIYPLHDVYVRKVKMLKKPKFELGKLMELHGEGGAGSAAKAPGD-DTGAKVERADG--YEPPIQESV
DAN10004|Rps3a       -----------DSVGKDIEKACQSIYPLHDVYVRKVKMLKKPKFELGKLMELHGEGGSTSAAAKPAEGDTGAKVERADG--YEPPIQESV
MED10004|Rps3a       -----------DSVGKDIEKACQSIYPLHDVYVRKVKMLKKPKFELGKLMELHGEGGAGGAAKASGD-DTGAKVERADG--YEPPIQETV
CIO10004|RPS3A       -----------DSIAKDIEKACQGIYPLHDVHIRKVKVLKKPKLDLGRLMEMHGEGSAK---TGQSKSDTGSKVERSGGDSYEPPVQDSV
DRO10004|RpS3A       -----------DSIAKDIEKSCQRIYPLHDVYIRKVKVLKKPRFDVSKLLELHGDGGGKSVEAVVS--SEGAVIDRPEG--YEPPVQEAV
MOS10004|Rps3a       -----------DSIAKDIEKACQVVYPLHDVYIRKVKVLKKPRFDLSSLMELHGDGGGKAAEVSTGA-ASGVVVDRPEG--YEPPVQASV
BEE10004|Rps3a       -----------DATAKDIEKASQGIYPLHDVYIRKVKVLKKPRFELSKLLELHGDGAGSKSEEVG---ESGSKVDRPEG--YEPPVQESV
CEL10004|rps-1       -----------DSIGKDIEKTCSKLYPLQEVYIRKVKIIKRPKVDLGRLHDLHGDSITVG--------ADGEKVDRPDD--YEPPVQQEV
BMA10004|RPS3A       -----------DSIGKDIEKACSYIYPLQDVCIRKVKILKKPKFEIGRLMEMHTDVSTFTS-------AEGEKIERPDD--YEPPVQESV
STE10004|RPS3A       -----------DSIGKDIEKSCQSIYPLHDVHIRKVKVLKKPKFDIGKLMEMHGEASS--HATTTTTDETGTKIDREGF---EPPIQDTV
MBR10004|RPS3A       -----------GTIGQEIQKKCQSIFPLQDVYIRKVKVLKKPRFDVSKLLELHGEAGG--------VTADKGKTVAKSGEFVEPKPQTSV
NEU10004|Rps3a       -----------EVIGREIEKATQGIYPLQNVHIRKVKLLKQPKFDLGALMSLHGE------------SGSDEAGQKVEREFKETVLESV-
GRI10004|Rps3a       -----------EVIGREIEKATQGIYPLQNVHIRKVKLLKQPKFDLGGLLALHGE------------STTDEQGQKVEREFKERVLEEV-
GRA10004|Rps3a       -----------EVIGREIEKSTQGIYPLQNVHIRKVKLLKAPKFDLGALMALHGE------------SGTDDQGQKVEREFKERVLEEV-
STA10004|Rps3a       -----------EVIGREIEKSTQGIYPLQNVHVRKVKLLKAPKFDLGALLGLHGE------------SSADDSGQKVEREFKETVLNEV-
YAR10004|Rps3a       -----------EVIGREIEKATQNIYPLQNVYIRKVKLLKQPKFDLGALLALHG-------------GATDDNGKKVNREFKDVVLESV-
POM10005|RPS3A-1     -----------EVIGRAIEKATNNIYPLQNVFVRKVKILKAPKHDAQKLLELHG-----------------ESQDVGSKVISDVAPLESV
POM10006|RPS3A-2     -----------EVIGREIERATGSIFPLQNVLVRKVKILKAPKHDAQKLLELHG-----------------ESQDVGTKVVKDVAPLESV
YST10005|RPS1A       -----------EVINKEIENATKDIFPLQNIHVRKVKLLKQPKFDVGALMALHGE------------GSGEEKGKKVT-GFKDEVLETV-
YST10006|RPS1B       -----------EVINKEIENATKDIFPLQNIHVRKVKLLKQPKFDVGALMALHGE------------GSGEEKGKKVS-GFKDEVLETV-
CIN10004|Rps3a       -----------EAIGREIEKASRSIYPLQNVYIRKAKILKAPKFDVSKLLELHG--DST--------DE---SGTRVTKDFKEPEVLESV
NEA10004|Rps3a       -----------ESIGREIEKAAKGIYPLHNVYVRKAKIVKTPKIDMSKLLESHG--EAM--------DTNTGSKVVKTGEFVEPEILESV
MAY10004|Rps3a       -----------EVIGREVEKATQGIFPLKDVYVRKVKVLKAPKDDLNKLLEVHGGAAIA--------GAEDAGVKARNTEFKEPAPLASV
RHI10014|Rps3a       Q-------SAQDAIAVRIEKACQGIYPLQNTYVRKVKILKAPKFDVSALLALHG--GAA--------AAGDDTGAKATKEFVEPPIQTSV
RHI10015|Rps3a-3     Q-------SAQDAIAVRIEKACQGIYPLQNTYVRKVKILKAPKFDVSALLALHG--GAA--------AAGDDTGAKATKEFVEPPIQASV
RHI10016|Rps3a-4     Q-------SAQDAIAVRIEKACQGIYPLQNTYVRKVKILKAPKFDVSALLALHG--GAA--------AAGDDTGAKATKEFVEPPIQASV
RHI10017|Rps3a-2     Q-------SAQDAIAVRIEKACQGIYPLQNTYVRKVKILKAPKFDVSALLALHG--GAA--------AAGDDTGAKATKEFVEPPIQASV
RHI10018|Rps3a-5     Q-------SAQDAIAVRIEKACQGIYPLQNTYVRKVKILKAPKFDVSALLALHG--GAA--------AAGDDTGAKATKEFVEPPIQASV
ARA10010|RPS3Aa      -----------EAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDVHGDYSAEDVGVKVDRPADEMAVEEPTEIIGA-------
ARA10011|RPS3Ab      -----------EAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMVEEPTEIIGA-------
RIC10010|RPS3Aa      -----------EVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEVHGDYAKEDIGTKLDRPAEDEAMAGQEVAAAE-------
GMA10014|LOC10080551 -----------EMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY-SEDVGAKVDRPADETLAEEATEVVGA-------
GMA10015|LOC10078157 -----------EMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEIHGDY-SEDVGVKVDRPVDETMPEGATEVVGA-------
GMA10017|LOC10081327 -----------EIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLMEVHGDY-SEDVGAKVDRPADEIVAEEPTEIVGA-------
GMA10018|LOC10081873 -----------EIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLMEVHGDY-SEDVGAKVDRPADEIVAEEPTEIVGA-------
GMA10019|LOC10080874 -----------EMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY-SEDVGAKVDRPADETLAEEATEVVGA-------
POP10004|RPS3A       -----------ESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY-SEDVGVKLDRPAEETMAEAPAETA---------
CRE10004|RPS3A       -----------ESIGKDIEKSCQGIYPLQNTFIRKVKVLKAPKFDITKLMEVHGDY-SEEVGAKIERPAAAAPAVEEAATA---------
VOL10004|RPS3A       -----------EAIGKDIEKSCQGIYPLQNTFIRKVKVLKAPKFDITKLMEVHGDY-SEEVGTKLDRPAAPAGEEAPAA-----------
HEM10004|rps3A       -----------EKLNSEIEKECRKIFPIHNFYIRKIKVLRENN-----------------------------------------------
PTR10004|RPS3A       -----------APIGDQIARTATSIFPIKDCYIRKVKVLKKPKFDVTELMEWHSADEKTAGDVGTPVAPVEETGLAGSGGRL--------
TPS10004|Rps3a       -----------GTTGEEIEREASSIFPIKDCYIRKVKVIKKPKFDVTALMEWHTDDGQDVGQN--VAPAVPEETVAGSGGRL--------
CYA10004|RPS3A       -----------EAIGKEIEKACKNIYPLQNVYIRKCKLIRAPKFDLTKLMEVHGDAPEDTGVRLEQGAAISGAASLQAETAQADAPVVGI
DIC10004|RPS3A       NGVTTNASGFAPTLAEKIRIEGSSIFPIHNVFIRKVKVLKTPKVDAAKLSELYASSATSTIAPTEEVGTAVERTEETTTTA---------
PLA10004|RPS3A       -----------ESIGKEIEKQCKKIYPLQNVLIRKVKILKRPKLDISKLMELHTDPKEESGKNVNALPESKEATNILTAELKH-------
TGO10004|RPS3A       -----------ESIGKDIENACKGIFPLQNVFIRKVKMLKKPKFDLTKLMELHGEAEDVG---RKVQAESGEAQNTLTAETKA-------
GIA10004|Rps3a       -----------FEVNAKLTEALQKITMCRDVMIRRVKVVKRPRNTMELLSTMHDSNQVRN-------LAEGQSIQQ--------------
HAL10033|VNG0787G    ------------RLSSAIYDEANTIYPLRRVEVEKATLEAHPEEVHEEEETAVDFSGE--------------------------------
MET10002|MJ0980      ------------EMAEKIKNECKKIFPIKNVIIYKSEVLSLAKKEENEGFVKEAEEETAEAQE---------------------------
PYR10036|PH0060      ------------KIAAEIAKEGKKIYPLKKAEIRKIKVLGEPEAA---------------------------------------------
SUL10038|ST0453      ------------KLSNDIFQQAKKIYPLRKVEVEKTKLLKAPA-----------------------------------------------