CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10002|VNG1697G    ----------------------MADELEFIEQGLQRSQIDEFFAEELARAGYGGMELAPTPMGMQIVLKAEKPGMVIGKGGKNIRKITTQLEERFD-LED
MET10003|MJ0461      -----------------------MIERTFVKENVKRLLIDEYFKKELSKAGYSHCDIRKTPIGTKIIIYAEKPGFVIGRRGSRIRELTETLAKEFG-VEK
PYR10002|PH1772      ----------------------MAIERYFIREAVKEMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILERQFG-LEN
THE10003|TTHA1686    MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTG--KN
SYN10004|sll1804     MGQKIHPVGFRLGITKDHKSCWYADPKRYPELLQEDHKIRQYIEKTLNNAGISDIRIERKAEQIELGIHTARPGVVVGRGGSGIEQLREGLQKLLGSARQ
BAC10003|Bsu0122     VGQKVNPVGLRIGVIRDWESKWYAG-KDYADFLHEDLKIREYISKRLSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTG--KR
ECO10003|rpsC        MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAG--VP
SUL10002|ST0424      ---------------------MVLVKKYFLQRSMTKVMVDEYLAKQFYNAEYAGVEIVKTPIGTRVIIYAGRPALIIGKGGKTIKQLAQMLERYFG-LDN


HAL10002|VNG1697G    PQIDVQEVEEPDLNAQIVADRLANALERGWYFRKAGHTTIDRIMESGALGAEIVLSGKVTGNRGRVEKFNRGYIKHNGEPAEEIVDHGKGVAVMKLGTIG
MET10003|MJ0461      PQIDVKPVENPDLDAQVVAQKVAQSLERGLHFRRVGHTAVRRVMNAGAKGVIVIISGKLTGERARTEKFMAGYMKHCGEPAEELVDKGRAIAKTKPGVIG
PYR10002|PH1772      PQIDVQEIKNPYLNAKVQAVRIAQALERGIHFRRAAYSAMRAIMNNGARGVEIRLSGKLTGERAKSVRFYQGYLAKVGNPAETLVSKGYAQALLKLGVIG
THE10003|TTHA1686    VALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAA-QGRVPLHTLRANIDYGFALARTTYGVLG
SYN10004|sll1804     IRVNVIEVPNADADAALMAEYIGQQLERRVSFRRVVRQALQRAERAEVKGIKIQVSGRLNGAEIARTEWVR-EGRVPLHTLRADIDYAYRTALTTYGILG
BAC10003|Bsu0122     VHINILEIKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARPEYYS-EGTVPLHTLRADIDYATSEADTTYGKLG
ECO10003|rpsC        AQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYR-EGRVPLHTLRADIDYNTSEAHTTYGVIG
SUL10002|ST0424      PQITVTSVENPELNARVMAFRLAIALEKGYHFRRAAFITIRRIMNAGALGAEVIISGKLTSERAKYEKLKEGVVYKSGAFLDKIVDRAVAIAMLKPGVYG


HAL10002|VNG1697G    VNVKIIPPNAELPDDFEIQEDADIEDLVVDEAEAGEDLEELLEGEDADAEDADADAAAEPESEPADFEDEEVIETDDDVEEELDELADAVEGEDEDDEFS
MET10003|MJ0461      VTVKIMRPDVLLPDEIIIKEDAEVKHVVEEEQ--------------------------------------------------------------------
PYR10002|PH1772      VKVAIMPPDARLPDEIEIVEKPAEEEVSTNEAE-------------------------------------------------------------------
THE10003|TTHA1686    VKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE----------------------------------------------------------
SYN10004|sll1804     IKVWIFKGEVIPGQEAAIVAPPSQPRRKSRRQQFDDRSQDG-----------------------------------------------------------
BAC10003|Bsu0122     VKVWIYRGEVLPTKKKNEEGGK------------------------------------------------------------------------------
ECO10003|rpsC        VKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK----------------------------------------------------------------
SUL10002|ST0424      VEILITKP-MKSVDKIELREQPKGPGENMVTVTNVSFIEESQKSGEQK----------------------------------------------------


HAL10002|VNG1697G    DVDDEAADTAEDLLDEMDDEDGGAE
MET10003|MJ0461      -------------------------
PYR10002|PH1772      -------------------------
THE10003|TTHA1686    -------------------------
SYN10004|sll1804     -------------------------
BAC10003|Bsu0122     -------------------------
ECO10003|rpsC        -------------------------
SUL10002|ST0424      -------------------------