CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10005|RPS4X       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENF
HUM10006|RPS4Y       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHF
DOG10005|Rps4x       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENF
MUS10005|Rps4x       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENF
RAT10005|Rps4x       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENF
FUG10005|RPS4X       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPTGFMDVISIDKTGEHF
DAN10005|Rps4x       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPTGFMDVVSIEKTGENF
MED10005|Rps4x       -MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDVTYPAGFMDVISIEKTGEHF
CIO10005|RPS4        -MARGPKKHLKRLNAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLCIFLRNRLHYALTYDETKRILMQRLVKVDGKVRTDTTYPAGFMDVITIDKTAEYF
DRO10005|RpS4        -MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFF
MOS10005|Rps4        -MARGPKKHLKRLNAPRGWMLDKTGGTFAPRPSTGPHKLRESLPLVIFLRNRLKYALTNSEVTKIVMQRHVKIDGKVRTDPNYPAGFMDVINIHKTGEYF
BEE10005|Rps4        -MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRESLPLVIFLRNRLKYALTNSEVTKIVMQRLIKVDGKVRTDANYPAGFMDVITINKTGEYF
CEL10005|rps-4       --MRGPKKHLKRLAAPSHWMLDKLGGVFAVRPNPGPHKLRESLPLSLFLRNRLKYALNYTEAKKILTQRVVRVDGKVRTCHKFPTGFMDVVAIERTNEYF
BMA10005|RPS4        -MARGPKRHLKRLAAPKHWMLDKLGGVFAPRPRCGPHKLRESLPLILFLRNRLKYALTYNEARMICKQRLIKVDGKVRTDMRFPAGFMDVIRIEKTNETF
STE10005|RPS4        -MARGPKKHMKRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEEVKKIVKQRLIKIDGKVRTDTTYPAGFMDVVTIDKTGENF
MBR10005|RPS4        -MARGPKKHLKRLAAPKHWMLDKLTGRYAPRPSTGPHKLRECLPLVIFLRNRLKYALTYHEVKMILKQRKVYVDGKARTDLTFPTGLMDVISIPDTNEHF
NEU10005|Rps4        -MGRGPKKHQKRLSAPSHWLLDKLSGVYAPRPSAGPHKLRECMPLIVFVRNRLKYALNYRETKAIMMQRLIKVDGKVRTDITYPAGFMDVITIEKTGENF
GRI10005|Rps4        -MGRGPKKHQKRLAAPSHWLLDKLSGTYAPKPSPGPHKQRECLPLIVFIRNRLKYALNGRETKAILMQRLVKVDGKVRTDSTYPAGFMDVVSIEKTGENF
GRA10005|Rps4        -MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYREVKAILMQRLVKVDGKVRTDSTFPSGFMDVITIEKTGENF
STA10005|Rps4        -MGRGPKKHQKRLSAPSHWLLDKLSGAYAPKASPGPHKLRDSLPLVIFLRNRLKYALNAREVNAILMQRLVKVDGKVRTDSTFPSGLMDVISIEKTGENF
YAR10005|Rps4        -MARGPKKHLKRLAAPSHWMLDKLSGTYAPRSSAGPHKLRESLPLVIFLRNRLKYALNGREVNAILMQRLVKVDGKVRTDSTFPAGFMDVIQLEKTGENF
POM10007|RPS4-1      -MVRGPKKHLKRVAAPHHWLLDKLSGTYAPKPSPGPHKARECLPLIVFLRNRLKYALNGREVKAILMQRLIKVDGKVRTDSTFPTGFMDVISVEKTGEHF
POM10008|RPS4-2      -MVRGPKKHLKRVAAPHHWLLDKLSGTYAPKPSPGPHKARECLPLIVFLRNRLKYALNGREVKAILMQRLIQVDGKVRTDSTFPTGFMDVISVEKTGEHF
POM10009|RPS4-3      -MVRGPKKHLKRVAAPHHWLLDKLSGTYAPKPSPGPHKARECLPLIVFLRNRLKYALNGREVKAILMQRLIKVDGKVRTDSTFPTGFMDVISVDKTGEHF
YST10007|RPS4A       -MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENF
YST10008|RPS4B       -MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENF
CIN10005|Rps4        -MARGPKKHLKRLAAPSSWMLDKLGGTYASRPSPGPHKLRESLPLTVFLRNRLKYALTGREVTSIVKQRLIKIDGKVRTDPTYPAGFMDVISIEKSGEHF
NEA10005|Rps4        -MGRGPKKHLKRLAAPSSWMLDKLGGTYAPRPSPGPHKLRESLPLTVFLRNRLKYALTGREVTAIVKQRLIKVDGKVRTDETFPAGFMDVISIERSGEHF
MAY10005|Rps4        -MVRGPKHHLKRLNAPSSWMLDKLSGTYAPRPSNGPHKLREALPLVILLRNRLKYALTGREVNAITAQRLIKIDGKVRTDPTYPTGFQDVVSIEKSGEHF
RHI10019|Rps4        -MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGREVQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENF
RHI10020|Rps4-2      -MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGREVQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENF
RHI10021|Rps4-3      -MARGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGREVQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENF
ARA10012|RPS4A       -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENF
ARA10013|RPS4B       -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENF
ARA10014|RPS4D       -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENF
RIC10013|RPS4A       -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENY
RIC10014|RPS4B       -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENY
GMA10020|LOC547645   -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENF
GMA10021|LOC10079522 -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENF
GMA10022|LOC10080179 -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENF
GMA10023|LOC10050000 -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENF
GMA10025|LOC10079522 -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENF
GMA10026|LOC10081133 -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENF
POP10005|RPS4        -MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESF
CRE10005|RPS4        -MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKEVQSILMQRLVKVDGKVRTDHTYPTGFMDVISMEKTDENF
VOL10006|RPS4        -MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKEVQSILMQRLVKVDGKVRTDHTYPTGFMDVISIEKTDEHF
HEM10005|rps4        -MAHGIKKHLKRLRAPKRWKLTKLGGIWAPNPKSGPHKKFESFPLILILRNRLKYALNNQEAVQILQQRSIKVDKKIRTEKNYPAGLMDIISIEKTEENF
PTR10005|RPS4        -MPRGPKKHLKRLNAPSHWNLGKMTGVFAPKPSPGPHKERECLPICIALRDRLKYALTNKECMQICMERCVKVDGKVRTDHNYPTGFMDVVELEKSGDRF
TPS10005|Rps4        -MARGPKKHLKRLNAPRHWNLGKMGGVWAPKPSAGPHKQRECLPVAIILRERLKYALTGKECQQICMERCVKIDGKVRTDHNYPAGFMDVVELEKSGDRF
CYA10005|RPS4        -MARGPKKHLKRLAAPRHWMLAKLGGIWAPRPSAGPHKLRECLPLIIILRNRLKYALTGREAMQILMQRLVRVDGKVRTDRTFPAGFMDVIHIEKTNETF
DIC10005|RPS4        -MARGPKKHLKRLAAPNHWMLDKLSGKWAPRPSSGPHKLRECLPLILVLRNRLKYALTKKEVTLILMQRLVKVDGKVRTDPNYPAGFMDVISIEKTKENF
PLA10005|RPS4        -MGKGIKKHLKRVNAPSHWMLNKMGGQYAPKTSSGPHKLLESIPLVILLRNRLKYALTFDEVKMILIQKIVKVDNKVRTDCTFPVGLMDVIHITKSNEYF
TGO10005|RPS4        -MARGPRKHLKRIAAPHHWMLDKLTGHYAPRPSPGPHKLRESVPLVVLLRNRLRYALTYREVMMIVMQRLIKVDNKVRTDQCYPAGFMDVISIEKTKENF
GIA10005|Rps4x       -MARGVRKHLKRLNAPKHWLLDKMGGIWAPRPTNGPHGLRECIPLILILRNRLHYANTYAETSMILQDKNVLIDGKPRTDPTFPVGFMDVFEIPKVHKTF
HAL10034|VNG1703G    -----MTNHQKRLSVPKSWPVERKTETFTAKAGAGPHG-ESGVPLVVVLRDVLEYVDDTSEAQYAINTDGVLVNGDSVGDVNRPIGMFDILAFPDRDEYY
MET10004|MJ0468      MAKKGPKRHLKRLAAPVRWELPRKIHKFTVRPLPGAHPMSESLPLLLIVRDILKYADNAREAKKIIKMGKVLVDGRVRKEEKLPVGLMDVVSLPDANENY
PYR10037|PH1766      MARKGPKRHLKRLAAPSSWYIERKAYKWAVRPRPGPHNMRTSIPLLYIVRDYLGYAKTAREARKILNEGKFLVDGKVRKDYKFPVGIMDVVSIPETGEHY
SUL10039|ST0421      -----------------------------------------------------------------------MVDGRVRKDYKFPVGLMDVISIPSSDLYF


HUM10005|RPS4X       RLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPL--------IKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGR
HUM10006|RPS4Y       RLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPV--------IKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGR
DOG10005|Rps4x       RLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPL--------IKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGR
MUS10005|Rps4x       RLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPL--------IKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGR
RAT10005|Rps4x       RLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPL--------IKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGR
FUG10005|RPS4X       RLIYDVKGRFTVHRITAEEAKYKLCKVKKILIGTKGIPHLVTHDARTIRYPDPL--------IKVNDTVRIDLDTGKITDFIKFDTSNMCMVTGGANLGR
DAN10005|Rps4x       RLIYDVKGRFTVHRITNEEAKYKLCKVRKILIGTKGIPHLVTHDARTIRYPDPL--------IKVNDTIRIDLDTGKITDFIKFETGNMCMVTGGANLGR
MED10005|Rps4x       RLIYDVKGRFTVHRITGEEAKYKLCKVRKIIIGTKGIPHLVTHDARTIRYPDPL--------IKVNDTVRIDLETGKITDFIKFDTGNLCMVTGGANLGR
CIO10005|RPS4        RLIYDVKGRFAVHRITSDEAKYKLCKVKKVATAPKGVPYLVTHDARTIRYPNPD--------IKVHDTVVVDIASGKITGFVHLDSGNMCMITGGHNLGR
DRO10005|RpS4        RLVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYPDPL--------IHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGR
MOS10005|Rps4        RLIYDVKGRFTVHRITSEEAKYKLLKVKRVQIGPKRVPFLLTHDGRTIRYPDPQ--------IHQHDSIQYDIATGKVLDVLKFEPGNLCMITGGRNLGR
BEE10005|Rps4        RLIYDVKGRFTTHRITAEEAKYKLCKVKRVQTGPKGIPFLVTHDGRTIRYPDPV--------IKVNDTIHLDIATGKILDSIRFDSGNLCMITGGRNLGR
CEL10005|rps-4       RMLYDTKGRYVVHRIQAAEADFKLCKVKSVRTVNKGVPVLTTTDGRTIRYPDPH--------VKVNDTIVFNISTQKITDSVKFEPGNLAYVTGGRNVGR
BMA10005|RPS4        RLLYDAKGRYATHRITEQEGNIKLCKIVKKCVGPKGVPFIVTHDARTIRYPDPH--------VKVNDTIVVDIATGKMSDYVKFDQGNLCMVTGGRNMGR
STE10005|RPS4        RLLYDVKGRFAVHRITAEEAKYKLGRVRRVDVGAKGVPYIVTHDARTIRYPDPN--------IKVNDTVVIDIKTGKVIDYIKFDTGNMAMVVGGRNMGR
MBR10005|RPS4        RLLFDTKGRYTVHKIQDDEASFKLCKVKQAAIGPNAVPYVVTHDGRTIRYPDPH--------IKVNDTVKVDLDSGRITDFIKFDIGVLVLCTGGRNMGR
NEU10005|Rps4        RLIYDTKGRFTVHRIQDEEAKYKLGKVKRVQLGKGGIPFLVTHDARTIRYPDPL--------IKVNDTVKINLETGKIEDFVKFDTGAIAMVTGGRNMGR
GRI10005|Rps4        RLVYDTKGRFTVHRIQAEEAEYKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPL--------IKVNDTVKINLDTGKITDFIKFDTGALAMVTAGNNMGR
GRA10005|Rps4        RLVYDTKGRFTVHRIQNEEAEYKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPL--------IKVNDTVKIDLATGKITDFIKFDTGAVVMVTGGRNMGR
STA10005|Rps4        RLIYDTKGRFTVHRITDEEAQYKLGKVKRVQLGKGGIPYLVTHDARTIRYPDPA--------IKVNDTVKIDLSTGKVSDFIKFDTGVIVMVTGGRNMGR
YAR10005|Rps4        RLVYDVKGRFAVHRITDEEAAYKLGKVKRVQVGKKGIPYLVTHDGRTIRYPDPL--------IKVNDTVKIDLATGKITSFVKFENGNIVMTTGGRNMGR
POM10007|RPS4-1      RLVYDIKGRFTVHRITAEEAKYKLCKVKRVQLGAKGVPFLVTHDGRTIRYPDPL--------IKVNDTIKLNLETNKIESFIKFDTSAQVMVTGGRNMGR
POM10008|RPS4-2      RLVYDIKGRFTVHRITAEEAKYKLCKVKRVQLGAKGVPFLVTHDGRTIRYPDPL--------IKVNDTIKLNLETNKIESFIKFDTSAQVMVTGGRNMGR
POM10009|RPS4-3      RLVYDIKGRFTVHRITAEEAKYKLCKVKRVQLGAKGVPFLVTHDGRTIRYPDPL--------IKVNDTIKLNLETNKIESFIKFDTSAQVMVTGGRNMGR
YST10007|RPS4A       RLVYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPN--------IKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGR
YST10008|RPS4B       RLVYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPN--------IKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGR
CIN10005|Rps4        RLLYDVKGRFTIHRITPEEATYKLLKVKRVALGARGVPHVVTHDGRTIRYPDPL--------IKVNDTVKFDLEQNKITDFVKFDTGNLVIVTGGRNMGR
NEA10005|Rps4        RLLYDVKGRFTIHRITPEEATFKLLKVRKHQLGAKGVPHIVTHDGRTIRYPDPA--------IKVNDTVKFDFVQNKIVDHIKFEPGNVVMVTGGRNMGR
MAY10005|Rps4        RILYDVKGRFIVHRITAEEATYKLLKVKKVQLGARGVPHIVTHDGRTIRYPDPA--------IKVNDTVRFDIDSQKILDFVAFDTGATVMVTGGRNQGR
RHI10019|Rps4        RLVYDVKGRFAVHRITDEEAKYKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPL--------IKTNDTIRFNIETGKIEDFVKFDVGNVVMVTGGRNIGR
RHI10020|Rps4-2      RLVYDVKGRFAVHRITDEEAKYKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPL--------IKTNDTIRFNIETGKIEDFVKFDVGNVVMVTGGRNIGR
RHI10021|Rps4-3      RLVYDVKGRFAVHRITDEEAKYKLCKVKKVLIGSKGVPYITTHDGRTIRYPDPL--------IKTNDTVRFNIETGKIEDFVKFDVGNIVMVTGGRNIGR
ARA10012|RPS4A       RLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPL--------IKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR
ARA10013|RPS4B       RLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPL--------IKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGR
ARA10014|RPS4D       RLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPL--------IKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGR
RIC10013|RPS4A       RLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPI--------IKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR
RIC10014|RPS4B       RLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPL--------IKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGR
GMA10020|LOC547645   RLLYDTKGRFRLHSVRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPL--------IRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR
GMA10021|LOC10079522 RLLYDTKGRFRLHSVIDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPL--------IRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR
GMA10022|LOC10080179 RLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPL--------IKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR
GMA10023|LOC10050000 RLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPL--------IKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGR
GMA10025|LOC10079522 RLLYDTKGRFRLHSVRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPL--------IRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR
GMA10026|LOC10081133 RLLYDTKGRFRLHSIRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPL--------IRANDTVKLDLEENKIVDFIKFDVGNVVMVTGGRNRGR
POP10005|RPS4        RLLYDTKGRFRLHSLRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPL--------IKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGR
CRE10005|RPS4        RLVLDTKGRFVVHRISKEEAAYKLCRVRKVEFGKGGVPYVITHDGRTIRYPDPE--------IKANDSIMLDIETGKIKEFVKNDVGALVMVTGGHNAGR
VOL10006|RPS4        RLVLDTKGRFVVHRISKEEAAYKLCRVRKVQFGKGGVPYVATHDGRTVRYPDPE--------VKANDSVMLDIETGKIKEYVKNDVGALVMVTGGHNAGR
HEM10005|rps4        RLLVDTFGRFILHRIEEKESMFKLCKVTKSTKGQRGIPYIVTHDGRTIRFPDPF--------IKTNDTILFDLSEKKIIDFIKFEVGSLCIITGGPNVGR
PTR10005|RPS4        RILFDSKGRFVLHRINREESQYKLCRINKIYIGSKKIPVAVTHDGRTIRYPDPD--------AKVNDTVKVDLATGKMSDIIKFELGAMVTLVRGRNAGR
TPS10005|Rps4        RLLYDTKGRFVLHRIQKDEAEYKLCRIQKGYMSAKKVPVAVTHDGRTLRFPDPD--------VAVNDTVKVNIATGKMSDIYKFEIGAMIMVTKGHNAGR
CYA10005|RPS4        RLLYDTKGRFVLHRITPEEGKYKLCRIKRQQLGARGIPYIVTHDGRTIRYPDPL--------IKVHDTVVLDIETGKITDFVKFDIGALCMITGGHNIGR
DIC10005|RPS4        RLLFDPKGRFTLQRITPEEAKFKLARVTRVETGNQGIPYVHTDDGRTIRYPDPA--------ISIHDTIKIDIESGKITAFIPFEVNNLCMIVGGHNLGR
PLA10005|RPS4        RLLYDIKGRFVPHRITNEESKYKLCKVKKILLRKGRLSIAVTHDGRSIPYIHPD--------VKVNDTVRLDLETGKVLEHLKFQVGSLVMVTAGHSVGR
TGO10005|RPS4        RMLFDTKGRFVPHPIREEEASYKLCRVKKVVVGPKGVPALITHDGRTMRYPHPS--------IKAHDCIRLDLNTGKIVDTLKFEAGNMAMVTGGHNVGR
GIA10005|Rps4x       RVLYDVKGRFTLVPIQSNEAGFKLCRVQKIFLGDKGMPYLSTHDARTIRFPHPD--------IKTNDTIKINLKTGKIDEWYKFDIGKIVMVTGGRNCGR
HAL10034|VNG1703G    RVFPDEGGRLGLTEIDADAAGSKLNKVTDKTTVSGGRTQLNFHDGSNLALDEDA--------YAGGDSVVVDTDTNEIVAHFQYEEGALVTAVAGQHAGD
MET10004|MJ0468      RVLFDRKGRIKLKPT--ENPDVKLCKIKNKTVIKGGHIQLNLHDGRNIVIKVSDPTKAEEDVYKTGDTLLISIPEQEIKAHIPFEVGKLAYITGGKHVGD
PYR10037|PH1766      RVLPNRIGKLVLHPISEEEANIKPLRIRNKRMVKGAKVQLNFHDGTNHLIPLTE-----KDNYFTSYTVLMKVPEREIMEVLPFEKGAYVFVTQGKNVAR
SUL10039|ST0421      RIVPDNIKYLMPVKISKEDAKYKFVRIVNKTTNKNGNIQLNLEDGRNILIPKEK---VPEMNYPTLTTLKIEIPSQNIIKSYELSEGKYAIIIGGRNVGL


HUM10005|RPS4X       IG---VITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLP-RGKGIRLTIAEERDKRLAAKQSSG------
HUM10006|RPS4Y       VG---VITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLP-RGKGIRLTVAEERDKRLATKQSSG------
DOG10005|Rps4x       IG---VITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLP-RGKGIRLTIAEERDKRLAAKQSSG------
MUS10005|Rps4x       IG---VITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLP-RGKGIRLTIAEERDKRLAAKQSSG------
RAT10005|Rps4x       IG---VITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLP-RGKGIRLTIAEERDKRLAAKQSSG------
FUG10005|RPS4X       IG---VITNRERHPGSFDVVHVKDSTGNSFATRLSNIFVIGKGNKPWVSLP-RGKGIRLTIAEERDKRLAAKQASS------
DAN10005|Rps4x       IG---VITNREKHPGSFDVVHVKDSIGNSFATRLSNIFVIGKGNKPWVSLP-RGKGVRLTIAEERDKRLAAKQSSS------
MED10005|Rps4x       IG---VITNRERHPGSFDVVHVKDSTGNSFATRLSNIFVIGKGNKPWVSLP-RGKGIRLTIAEERDKRLAAKQGSS------
CIO10005|RPS4        VG---TVMHRERHPGSFDIIHVKDALGHTFATRLSNVFIIGQANKPMVSLP-RGKGIKLTIAEERDRRLATK----------
DRO10005|RpS4        VG---TVVNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLP-KGKGVKLSIAEERDKRLAAKTH--------
MOS10005|Rps4        CG---TVILREKHPGSFEIVHVKDTTGHVFATRLSNVFIIGKSTKAYISLP-KGKGVKLTIAEERDRRLANKAAQ-------
BEE10005|Rps4        VG---TVVSRERHPGSFDICHIKDSQGHTFATRLNNVFIIGKGTKPYISLP-RDKGVKLSIAEERDKRLAAKGVN-------
CEL10005|rps-4       VG---IIGHRERLPGASDIIHIKDSAGHSFATRISNVFVIGKGNKALVSLP-TGAGIRLSIAEERDKRMAQKH---------
BMA10005|RPS4        VG---IVGHREKHPGSFDIVHIKDAADHSFATRLNNVFIIGKGTKSIVSLPGPTKGVRLTIAEERDRRLAQKRAA-------
STE10005|RPS4        VG---MVTHREKHAGSFDIVHVKDATGHQFATRLTNIFVIGKGNKPYVSLP-KGKGVRLSIAEERDRRIAEKAKMM------
MBR10005|RPS4        VG---TLMSRDKMMGATDVVHVRDSAGQQFTTLLSNVFAVGSGKKPAISLP-RGKGVRLTIAEERDRRLKDKAKAAA-----
NEU10005|Rps4        VG---VITHRERHDGGFNIIHVKDALDNTFATRESNVFVIGSE-KPWISLP-KGKGVKLSIAEERDRRRANALAH-------
GRI10005|Rps4        VG---VITHRERHDGGFNIVHLKDAIDNTFTTRESNVFVIGTE-KPWISLP-KGKGVKLTIAEERDRRRAQTIAGH------
GRA10005|Rps4        VG---VITHRERHDGGFNIVHVKDAIDNSFATRESNVFIIGQD-KPWISLP-KGKGVKLTIAEERDRRRAYAISH-------
STA10005|Rps4        VG---VITHRERHDGGFNIVHLKDAVDNEFTTRETNVIVIGKE-KPWISLP-KGKGVKLSIAEERDRRRAYALAGN------
YAR10005|Rps4        VG---TITHRERHEGGFDIVHIKDALDNQFVTRLTNVFVIGEGNKSLISLP-KGKGIKLSIAEERDARRAKQE---------
POM10007|RPS4-1      VG---TIVHREHHLGSFEIIHVKDALDREFATRLSNVFVIGETGKSWISLP-KGKGVKLSITEERDRRRALKGLA-------
POM10008|RPS4-2      VG---TIVHREHHLGSFEIIHVKDALDREFATRLSNVFVIGEAGKSWISLP-KGKGVKLSITEERDRRRALKGLA-------
POM10009|RPS4-3      VG---TIVHREHHLGSFEIIHVKDALDREFATRLSNVFVIGETGKSWISLP-KGKGVKLSITEERDRRRALKGLA-------
YST10007|RPS4A       IG---TIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLP-KGKGIKLSIAEERDRRRAQQGL--------
YST10008|RPS4B       IG---TIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLP-KGKGIKLSIAEERDRRRAQQGL--------
CIN10005|Rps4        AG---TIVHKEKHVGGFDIVHIKDSLDRTFATRVSNVFVIGEGTKAWISLP-KGKGLKLTIAEERDVRRKRAAADQ------
NEA10005|Rps4        SG---VIVHKERHLGGFDIVHVKDVLDRTFATRLSNIFVIGEGSKAQVSLP-KGKGVKLSIAEERDQRRRQRAQEA------
MAY10005|Rps4        AG---VITGKERHLGGFDIVHIRDVLGRDFSTRLSNVFVIGTDGKPMISMP-RGGGVKLTITEERDQRRRQKEARGQ-----
RHI10019|Rps4        VG---QLVHRERHIGGFEIVHIKDALDHVFATRISNVFTIGQGNKPWISLP-KGKGVKLSITEERDRRRAAAAAQ-------
RHI10020|Rps4-2      VG---QLVHRERHIGGFEIVHIKDALDHVFATRISNVFTIGQGNKPWISLP-KGKGVKLSITEERDRRRAAAAAN-------
RHI10021|Rps4-3      VG---QLVHRERHIGGFEIVHIKDALDHVFATRISNVFTIGQGNKSWISLP-KGKGVKLSITEERDRRRAAATAAQ------
ARA10012|RPS4A       VG---VIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLP-KGKGIKLTIIEEARKRLSAQQA--------
ARA10013|RPS4B       VG---VIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLP-KGKGIKLTIIEEARKRLASQQAA-------
ARA10014|RPS4D       VG---VIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLP-KGKGIKLTIIEEARKRLASQQAA-------
RIC10013|RPS4A       VG---VIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNKPWVSLP-KGKGIKLSIIEEQRKRDAAAQAAANA----
RIC10014|RPS4B       VG---VIKNREKHKGSFETIHVEDALGHAFATRLGNVFTIGKGNKPWVSLP-KGKGIKLSIIEEQRKRDAAAQAAANA----
GMA10020|LOC547645   VG---VIKNREKHKGSFETIHVQDSTGHEFATRMGNVFTIGKGTKPWISLP-KGKGIKLSIIEEARKRIAAQQATAA-----
GMA10021|LOC10079522 VG---VIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLP-KGKGIKLSIIEEARKRIAAQQATAA-----
GMA10022|LOC10080179 VG---VIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTKPWVSLP-KGKGIKLSIIEEARKRLAAQNETVA-----
GMA10023|LOC10050000 VG---VIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTKPWVSLP-KGKGIKLSIIEEARKRLAAQKETVA-----
GMA10025|LOC10079522 VG---VIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLP-KGKGIKLSIIEEARKRIAAQQATAA-----
GMA10026|LOC10081133 VG---VIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLP-KGKGIKLSIIEEARKRIAAQQATTA-----
POP10005|RPS4        VG---VIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWISLP-KGKGIKLSIIEEARKRLAASQATA------
CRE10005|RPS4        VG---KIVHKEKHKGSFEIVHIEDAAGNRFATRLTNIFVIGKEGKPLISLP-KGKGIRLTIIQEQKKRYEAGQA--------
VOL10006|RPS4        VG---KIVHKEKHKGSFEIVHIEDAAGNRFATRLTNIFVIGKEGKPLISLP-KGKGIRLTIIQEQKKRYEAASA--------
HEM10005|rps4        IG---IVLQQGKNFLEEEMIKLKDAKGSEFSTKFSFIFVIGKGKKSFISLP-KGKGIREIQFD-------------------
PTR10005|RPS4        VG---TLMHIERHLNSFDIVTVKDAKGHTFATRLHNVFVIGNGTTPQISLP-KGRGIKKSIIEERAEAEAAGRI--------
TPS10005|Rps4        VG---TLEHVEKHDGSFSIVTIKDKKGNTFATRQANVFVIGSGDHPQVTLP-KGRGIKKTILQERAEAEARGDL--------
CYA10005|RPS4        VG---VVQHRERHPGATEIVHLKDAAGREFATQISNVFVIGRE-KSLVSLP-RGKGVKLSVVEERERRGLL-----------
DIC10005|RPS4        VG---AVTHREKHPGSFDIVHVTDTAGHQFATRLSNVFIIGKASQTFVSLP-AGKGVRRSRVDERNAALKRRGEKIETVA--
PLA10005|RPS4        VG---VISSIDKNMGTYDIIHVKDSRNKVFATRLSNVFVIGDNTKPYISLP-REKGIKLDIIEERRNRLKALNN--------
TGO10005|RPS4        VG---VIVHRERHLGGFDIIHLRDAKNNEFATRISNVFVIGKGEKAWISLP-KEKGIRLSIMENRQVLLKKQQMNN------
GIA10005|Rps4x       IG---TIQAIDKHMGSYTMIRMKDTEGTEFLTRLCNVFVIGNDSPAVAIPT--TKGIRPDIIKNRELRLRSIAKRGGGASYE
HAL10034|VNG1703G    IG---EIAEINVQPGSASNTVRVDDENGGFETIAEYVVVIDENFVEEDDE--------------------------------
MET10004|MJ0468      F--AKIVEIERR-GIYPDIVTLENMDGEKFKTVKDYVFVVGDEEPIIKL---------------------------------
PYR10037|PH1766      K--GRIVEIKKFPMGWPDVVTIEDEEGELFDTLKEYAFVVGKDKPKISLP--------------------------------
SUL10039|ST0421      HGVIKTIQYAKYKKRKYSIVTIEQKNGESVQTNLQNVMVIGDSEIDPNVGVR------------------------------