CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10004|VNG1715G    ---------MSYNDTWQPKTRLGGLVQDGEVEDMSEALDTGLPLKEPEIVDQLLPGLDD----EVLDINMVQRMTDSGRRVKFRCVVAIGNRDGYVGYAE
MET10006|MJ0475      --------MRFNIDEWEPKTTIGRMVKEGQITDIDYILDNNLPILEPEIVDALLPDLEEK----VLDVKLVQRMHKSGRRARFRATVVVGNRNGYVGVGK
PYR10004|PH1757      MSQDWKEYAKRVLDEWQPRTKLGMLVKEGQITDIHEIFRRGYQIKEPEIIDVLLPEVNARENQEIIDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGI
THE10005|TTHA1675    -------------------------------------------------------MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGF
SYN10006|sll1812     --------------------------------------------MAKRRKTSREKKEDTNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNETGQVGVGV
BAC10005|Bsu0133     --------------------------------------------------MRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGT
ECO10005|rpsE        --------------------------------------------------MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGY
SUL10004|ST0414      ---MAEEVPVINPEEWKPRTKVGQLVKEGKITSMKEIFEKNYPITEPEIVDVLLPKLKY----EVMDIKIVQKQTDAGEISKYKVLIVMGNMDGYVSYGT


HAL10004|VNG1715G    GRDDQVGGAIQKAIEVAKLNIIDVSRGCGSWECGCGRPHTVALKSTGKAGSVDVELMPAPRGLGLAGGETVQHVLELAGIDDVWTRSSGKTRTTVNFAKA
MET10006|MJ0475      GKAKEVGPAIRKAIAQAKKNIIRVKRGCGSWECGCGTPHSIPYKGYGKCGSTAIEILPAPKGVGLVAGDVAKAVLGLAGIKDVWTKTFGETRTTYNFAMA
PYR10004|PH1757      GHGREVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFAVEGKEGSVRVRLIPGPRGLGLVIGDVGKKILRLAGIQDVWSQTFGETRTTVNFAKA
THE10005|TTHA1675    GKAPEVPLAVQKAGYYARRNMVEVPLQN----------GTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELG-SRNPINIAYA
SYN10006|sll1812     GKAGDVIGAVRKGVADGKKQLIEVPLTKS---------NSITHITNGVSGGAKVVVRPAAPGTGVIAGGAVRTVLELAGVKNILAKQLG-SNNPLNNARA
BAC10005|Bsu0133     GKAQEVPEAIRKAVEDAKKNLIEVPMVG----------TTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELAGVADILSKSLG-SNTPINMIRA
ECO10005|rpsE        GKAREVPAAIQKAMEKARRNMINVALNN----------GTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYG-STNPINVVRA
SUL10004|ST0414      GKAKQLRVAIQKAIKNAKMNIIPVRRGCGSWECTCGEAHSLPFKVYGKAGSVEVLLMPAPKGTGLVVGPALKTLLTYAGIKDAWSLTRGSTYTTENFIKA


HAL10004|VNG1715G    TFNALRETSEARVPQHAREEREVIE-----------
MET10006|MJ0475      TFEALKSLNFTRTMEKHKEKLGIVEGRVL-------
PYR10004|PH1757      VFNALYNTNRVVVTPEMIERYGIVVGRAMPTSFTLE
THE10005|TTHA1675    TMEALRQLRTKADVERLRKGEAHAQAQG--------
SYN10006|sll1812     AINALETLRTFSEVAEERGVSVEHLYT---------
BAC10005|Bsu0133     TLQGLSELKRAEDVAKLRGKSVEELLG---------
ECO10005|rpsE        TIDGLENMNSPEMVAAKRGKSVEEILGK--------
SUL10004|ST0414      GYNALYNTYKFVTPVDWMRRK---------------