CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10008|RPS6        ------MKLNISFPAT-GCQKLIEVD-DERKLRTFYEKRMATEVAADALG-EEWKG--------------------------------------------
DOG10007|Rps6        ------MKLNISFPAT-GCQKLIEVD-DERKLRTFYEKRMATEVAADALG-EEWKG--------------------------------------------
MUS10007|Rps6        ------MKLNISFPAT-GCQKLIEVD-DERKLRTFYEKRMATEVAADALG-EEWKG--------------------------------------------
RAT10007|Rps6        ------MKLNISFPAT-GCQKLIEVD-DERKLRTFYEKRMATEVAADALG-EEWKG--------------------------------------------
CHK10007|Rps6        ------MALNISFPAT-GCQKLIEVD-DERKLRTFYEKRMATEVAADSLG-EEWKG--------------------------------------------
FUG10007|RPS6        ------MKLNISFPAT-GCQKLIEVD-DERKLRTFYEKRMATEVAADPLG-DEWKG--------------------------------------------
DAN10007|Rps6        ------MKLNISFPAT-GCQKLIEVD-DERKLRIFYEKRMATEVAADSLG-DEWKG--------------------------------------------
MED10007|Rps6        ------MKLNISFPAT-GCQKLIEVD-DERKLRTFYEKRMATEVAADPLG-DEWKG--------------------------------------------
CIO10007|RPS6        ------MKLNISFPAT-GCQKVFEVD-DEQKLRVFYDRRMSQEVSADGLG-DEWKG--------------------------------------------
DRO10009|RpS6        ---------------------------------------MGQVVEADILG-DEWKG--------------------------------------------
MOS10007|Rps6        ------MKLNVSFPAT-GAQKTFEIPSDDHKLRHFYDKRMGTEIGADHLG-EEWKG--------------------------------------------
BEE10007|Rps6        ------MKLNVSYPAT-GCQKLFEIS-DEHKLRIFYEKRMGAEVEADALG-NEWKG--------------------------------------------
CEL10007|rps-6       ------MRLNFAYPAT-GLQKSFEVD-EEKKLRLFFEKRMSQEVAIDALG-DEWKG--------------------------------------------
BMA10007|RPS6        ------MKLNIAYPTT-GCQKVFEID-DEKKLRIFYEKRMAQEVEADALG-DEWKG--------------------------------------------
STE10007|RPS6        ------MKLNISYPVT-GCQKLIEIE-DERKVRSFYDKRMAMEVSGECLG-DEWKG--------------------------------------------
MBR10007|RPS6        ------MKLNISYPPN-GTQKTYDFE-NEAAVRPFYEKRISAEVPADSLG-DDWKG--------------------------------------------
NEU10007|Rps6        ------MKLNISYPAN-GSQKLIEVE-DERKLRHFIEKRMGAEVPADPLG-DEWKG--------------------------------------------
GRI10007|Rps6        ------MKFNISNPST-GAQKLVEVE-DERKLRFFMEKRMGAEVSAEPLG-DEWKG--------------------------------------------
GRA10007|Rps6        ------MKLNISYPAN-GSQKLIDIE-DERKVRVFMDKRMGAEVPGDSVG-DEFKG--------------------------------------------
STA10007|Rps6        ------MKLNVSYPNN-GTQKLIEIE-DERKLRVFMDRRMGHEVPGDSVG-DEFKG--------------------------------------------
YAR10007|Rps6        ------MKLNIAYPAQ-GTQKCIDIE-DEHRVRGFYEKRMGQEVEADFLG-DEFKG--------------------------------------------
POM10012|RPS6-1      ------MKLNISYPAN-GTQKLIEID-DDRRLRVFMEKRMGQEVPGDSVG-PEFAG--------------------------------------------
POM10013|RPS6-2      ------MKLNISYPAN-GTQKLIEID-DDRRLRVFMEKRMGQEVPGDSVG-PEFAG--------------------------------------------
YST10010|RPS6A       ------MKLNISYPVN-GSQKTFEID-DEHRIRVFFDKRIGQEVDGEAVG-DEFKG--------------------------------------------
YST10011|RPS6B       ------MKLNISYPVN-GSQKTFEID-DEHRIRVFFDKRIGQEVDGEAVG-DEFKG--------------------------------------------
CIN10007|Rps6        ------MKFNIANPAT-GAQKLLDID-DEKRFRVFYDKRISQEVPGDSLG-DEWKG--------------------------------------------
NEA10007|Rps6        ------MKVNFSNPAT-GAQKLIDFE-DERKTRVFMEKRMGQEVAIDSLG-EEFAG--------------------------------------------
MAY10007|Rps6        ------MKLNVANPAT-GAQKSFDIQ-DERLVRCFYEKRMSQDVEVDSLG-EEWKG--------------------------------------------
RHI10026|Rps6        ------MKLNIANPAT-GCQKLIEIE-DERRLRGFYDKRMAQEVSGDTLG-DEFKG--------------------------------------------
RHI10027|Rps6-2      ------MKLNIANPAT-GCQKLIEIE-DERRLRGFYDKRMAQEVSGDTLG-DEFKG--------------------------------------------
RHI10028|Rps6-3      ------MKLNIANPAT-GCQKLIEIE-DERRLRGFYDKRMAQEVSGDTLG-DEFKG--------------------------------------------
RHI10029|Rps6-4      ------MKLNIANPAT-GCQKLIEIE-DERRLRGFYDKRMAQEVSGDTLG-DEFKG--------------------------------------------
RHI10030|Rps6-5      ------MKLNIANPAT-GCQKLIEIE-DERRLRGFYDKRMAQEVSGDTLG-DEFKG--------------------------------------------
ARA10017|RPS6A       ------MKFNVANPTT-GCQKKLEID-DDQKLRAFYDKRISQEVSGDALG-EEFKG--------------------------------------------
ARA10018|RPS6B       ------MKFNVANPTT-GCQKKLEID-DDQKLRAFFDKRLSQEVSGDALG-EEFKG--------------------------------------------
RIC10018|RPS6A       ------MKFNIANPTT-GCQKKLEID-DDQKLRAFFDKRISQEVSGDALG-EEFKG--------------------------------------------
RIC10019|RPS6B       ------MKFNIANPTT-GCQKKLEID-DDQKLRAFYDKRISQEVSGDALG-EEFKG--------------------------------------------
GMA10031|LOC10078655 ------MKFNIANPTT-GCQKKLEID-DDLKLRAFWDKRISQEVLGDALG-EEFKG--------------------------------------------
GMA10032|LOC10080407 ------MKFNIANPTT-GCQKKLEID-DDLKLRAFWDKRISQEVIGDALG-EEFKG--------------------------------------------
GMA10034|RPS6        ------MKFNIASPTT-GCQKKLEID-DDQKLRAFWDKRISQEVSGDALG-EEFKG--------------------------------------------
GMA10035|LOC10080119 ------MKFNIANPTT-GCQKKLEID-DDLKLRAFWDKRISQEVVGDALG-EEFKG--------------------------------------------
GMA10036|LOC10080050 ------MKFNIANPTT-GCQKKLEID-DDLKLRAFWDKRISQEVVGDALG-EEFKG--------------------------------------------
GMA10037|LOC10081969 ------MKFNIANPTT-GCQKKLEID-DDLKLRAFWDKRISQEVLGDALG-EEFKG--------------------------------------------
GMA10038|LOC10079294 ------MKFNIANPTT-GCQKKLEID-DDQKLRAFWDKRISQEVNIDALG-EEFKG--------------------------------------------
POP10007|RPS6        ------MKFNIANPTT-GCQKKLEID-DDQKLRAFFDKRISQEVSGDALG-EEFKG--------------------------------------------
CRE10007|RPS6        ------MKLNIAYPAT-GCQKKLEVD-DEAKLRAFYDRRVAAEVDGEVLG-EEFKG--------------------------------------------
VOL10008|RPS6        ------MKLNIAYPAT-GCQKKLEVD-DDAKLRAFYDKRLAAEVDGEALG-EEFKG--------------------------------------------
HEM10007|rps6        ------MKLNIANPKN-GAQKIIEIE-NENDLRIFFDKKITNEIDVSSLG-DEWKG--------------------------------------------
PTR10007|RPS6        ------MKINIACPST-GMQKVIEID-DERRLQNLYDRRMAQEIDGTILG-DEFEG--------------------------------------------
TPS10007|Rps6        ------MKINIAVPST-GLQKVIEID-DEKRLQNLYERRMAQEIDGAVLG-EEFAG--------------------------------------------
CYA10007|RPS6        ------MKFNVANPAT-GCQKQFEID-DESRLRAIYDKRIAQEVDGEALLGEEFRG--------------------------------------------
DIC10007|RPS6        ------MKLNIAYPVN-GSQKKINIE-DKNKVRCFMEKRIGQEVEATTLG-DEFKG--------------------------------------------
PLA10007|RPS6        ------MKLNISNPLN-NVQKSIEID-DEKKLLPFMEKRIGNAVPGDSIG-EEFTG--------------------------------------------
TGO10007|RPS6        ------MKLNLANPQA-GMQKTVEVD-DEKKLLPFFEKRMGAEVAGDSIG-DEFKG--------------------------------------------
GIA10007|Rps6        MPKGSFCKVNISNPVT-GANKSLMIE-DFRKSQTIHGLRMASEFDGAALG-EEYAG--------------------------------------------
HAL10035|VNG2514G    ---MATFQVAVADP---ESGRTYQFEVDGQDANRFIGREIGAAVDGGAVGLDG-----------------------------------------------
MET10007|MJ1260      ---MPTAKFVVADP------KTGRCYQIEADNTPLVGKKIGEVFDGKIIGLEG-----------------------------------------------
PYR10038|PH0615      ---MTTFKLVISDP---KSGIAKQIEISGANAEKLIGKKIGDQIPVKELGLDLKALFGKD----------------------------------------
SUL10040|ST0382      ---LPDFKIVISDPQTKESKIKKVKVKVSDQIQSIQGEKEGKALPIAKINQKLKEELGLDTLLTLQTIKQEGDKKVKVKTHFKIEIDNNVPSDEVWIAAS


HUM10008|RPS6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYR--PRRTGERKRKS
DOG10007|Rps6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYR--PRRTGERKRKS
MUS10007|Rps6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYR--PRRTGERKRKS
RAT10007|Rps6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYR--PRRTGERKRKS
CHK10007|Rps6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYR--PRRTGERKRKS
FUG10007|RPS6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTNGRVRLLLSKGHSCYR--PRRTGERKRKS
DAN10007|Rps6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYR--PRRTGERKRKS
MED10007|Rps6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTQGRVRLLLSKGHSCYR--PRRTGERKRKS
CIO10007|RPS6        -------------------------------------------------YIVRITGGNDKQGFPMKQGVLTAGRVRLLLGKGHSCYR--PRRTGERKRKS
DRO10009|RpS6        -------------------------------------------------YQLRIAGGNDKQGFPMKQGVLTHGRVRLLLKKGHSCYR--PRRTGERKRKS
MOS10007|Rps6        -------------------------------------------------YILKIAGGNDKQGFPMKQGVLTNTRVRLLLKKGHSCYR--PRRAGERKRKS
BEE10007|Rps6        -------------------------------------------------YVVRISGGNDKQGFPMKQGVLTNGRVRLLLSKGHSCYR--PRRDGERKRKS
CEL10007|rps-6       -------------------------------------------------YVVRIGGGNDKQGFPMKQGILTNGRVRLLLKKGQSCYR--ERKNGERKRKS
BMA10007|RPS6        -------------------------------------------------YVLRITGGNDKQGFPMKQGVLTNGRVRLLLSKGHSCYR--ARRDGERKRKS
STE10007|RPS6        -------------------------------------------------YVFRITGGNDKQGFPMKQGIMTNGRVRLLLSKGHSCYR--PRRTGERKRKS
MBR10007|RPS6        -------------------------------------------------YVLRISGGNDKQGFPMRQGVLTNRRVKLLMSEGHSGYR--PRRSGERKKKS
NEU10007|Rps6        -------------------------------------------------YILRITGGNDKQGFPMKQGVIAPNRVRLLLSDGHSCYR--ARRTGERKRKS
GRI10007|Rps6        -------------------------------------------------YILKITGGNDKQGFPMKQGVLLPNRTRLLLSDGHSCYR--ARRTGERKRKS
GRA10007|Rps6        -------------------------------------------------YIFRITGGNDKQGFPMKQGVMHPTRVRLLLSEGHSCYR--PRRTGERKRKS
STA10007|Rps6        -------------------------------------------------YVLRITGGNDKQGFPMKQGVMHPTRVRLLLADGHSCYR--PRRTGERKRKS
YAR10007|Rps6        -------------------------------------------------YVLKITGGNDKQGFPMKQGVMHPTRVRLLLSKDSSCYR--SRRAGERKRKS
POM10012|RPS6-1      -------------------------------------------------YVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYR--PRRDGERKRKS
POM10013|RPS6-2      -------------------------------------------------YVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYR--PRRDGERKRKS
YST10010|RPS6A       -------------------------------------------------YVFKISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYR--PRRDGERKRKS
YST10011|RPS6B       -------------------------------------------------YVFKISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYR--PRRDGERKRKS
CIN10007|Rps6        -------------------------------------------------YIFRVTGGNDKQGFPMKQGVLVPNRVRLLLSDGHSCFR--PRRSGERKRKS
NEA10007|Rps6        -------------------------------------------------YVVRITGGNDKQGFPMKQGVLLQHRTRLLLSDGHSCYR--ARRDGERKRKS
MAY10007|Rps6        -------------------------------------------------YVLRIGGGNDKQGFPMKQGVLLPNRVRLLLSKGDSCYR--PRRTGERKRKS
RHI10026|Rps6        -------------------------------------------------YVFRITGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYR--PRRTGERKRKS
RHI10027|Rps6-2      -------------------------------------------------YVFRITGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYR--PRRTGERKRKS
RHI10028|Rps6-3      -------------------------------------------------YVFRITGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYR--PRRTGERKRKS
RHI10029|Rps6-4      -------------------------------------------------YVFRITGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYR--PRRTGERKRKS
RHI10030|Rps6-5      -------------------------------------------------YVFRITGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYR--PRRTGERKRKS
ARA10017|RPS6A       -------------------------------------------------YVFKIKGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKS
ARA10018|RPS6B       -------------------------------------------------YVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKS
RIC10018|RPS6A       -------------------------------------------------YVFKIMGGCDKQGFPMKQGVLTAGRVRLLLHRGTPCFRGYGRRDGERRRKS
RIC10019|RPS6B       -------------------------------------------------YVFKIMGGCDKQGFPMKQGVLTSGRVRLLLHRGTPCFRGYGRRDGERRRKS
GMA10031|LOC10078655 -------------------------------------------------YVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKS
GMA10032|LOC10080407 -------------------------------------------------YVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKS
GMA10034|RPS6        -------------------------------------------------YVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKS
GMA10035|LOC10080119 -------------------------------------------------YVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKS
GMA10036|LOC10080050 -------------------------------------------------YVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKS
GMA10037|LOC10081969 -------------------------------------------------YVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKS
GMA10038|LOC10079294 -------------------------------------------------YVFKITGGCDKQGFPMKQGVLTPGCVHLLLHRGTPCFRGYGRRNGERRRKF
POP10007|RPS6        -------------------------------------------------YVFKIMGGCDKQGFPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKS
CRE10007|RPS6        -------------------------------------------------YVLKIAGGQDKQGFAMKQGVLTNARVRLLMTPGDQGFRGYGRRKGERRRKS
VOL10008|RPS6        -------------------------------------------------YVLKIAGGQDKQGFAMKQGVLTNGRVRLLMTPGDQGFRGHGRRKGERRRKS
HEM10007|rps6        -------------------------------------------------FILKITGGQDKQGFPMKEGVLSNKRVKLLLSKGVSGCRGFGMKKGEKVRKS
PTR10007|RPS6        -------------------------------------------------YILRISGGNDKQGFPMRQGVLTNTRVSLLCKKGHKAYR--QRRAGERKRKS
TPS10007|Rps6        -------------------------------------------------YVLRITGGNDKQGFPMRQGILCNHRVRLLMHKGHKGYR--QRRAGERKRKS
CYA10007|RPS6        -------------------------------------------------TILRIMGAQDKEGFPARLGVLTPNRVRLLMHKGDVGCRGYGMRDGERKRRS
DIC10007|RPS6        -------------------------------------------------YVFKITGGNDTEGFPMMQGVGAPTRVRLLLDGRSGCFK--PSRDGERKRKS
PLA10007|RPS6        -------------------------------------------------YVFRITGGNDKQGFPMIQGVLTNNRVRLLFKKGMKCYR--PRKKGERKRKS
TGO10007|RPS6        -------------------------------------------------YIFRISGGNDKQGFPMMQGVLVNHRVRLLFRKGMKCYR--QRRTGEKKRKS
GIA10007|Rps6        -------------------------------------------------CTFRITGGNDAQGFPMYQGVLKSQRARLLLRQGAKCYLH--RRNGERKRKS
HAL10035|VNG2514G    -------------------------------------------------YTVEITGGSDDAGRPMREDVDGSDLMEVLLEGGAGFNP---DEDGERKRVT
MET10007|MJ1260      -------------------------------------------------YKLQIRGGTDSSGFPMRPDIHGSRKVRVLLSAPPGFKP---KRKGERRRKT
PYR10038|PH0615      ---------------------------------------------FPEDVKMEIRGGTDKDGFPMRPDIHGPRRVRILLSKGPGFRP---KEKGERRKKT
SUL10040|ST0382      IAEKYGANEFEAEAYRTKSFQLSIDQSKLSNIIGAKIGDVIELNVSGIPLKVKITGGSDNSGFPMRYDVPGGAKRKLLLSGPPGFYP---EEDGMRRKKT


HUM10008|RPS6        VRGCIVDANLSVLNLVIVKKGEKDIPGLT--DTTVPRRLGPKRASRIRKLFNLS------KEDDVRQYVVR--KPLNK-EGKKPRTKAPKIQRLVTPRVL
DOG10007|Rps6        VRGCIVDANLSVLNLVIVKKGEKDIPGLT--DTTVPRRLGPKRASRIRKLFNLS------KEDDVRQYVVR--KPLNK-EGKKPRTKAPKIQRLVTPRVL
MUS10007|Rps6        VRGCIVDANLSVLNLVIVKKGEKDIPGLT--DTTVPRRLGPKRASRIRKLFNLS------KEDDVRQYVVR--KPLNK-EGKKPRTKAPKIQRLVTPRVL
RAT10007|Rps6        VRGCIVDANLSVLNLVIVKKGEKDIPGLT--DTTVPRRLGPKRASRIRKLFNLS------KEDDVRQYVVR--KPLNK-EGKKPRTKAPKIQRLVTPRVL
CHK10007|Rps6        VRGCIVDANLSVLNLVIVKKGEKDIPGLT--DTTVPRRLGPKRASRIRKLFNLS------KEDDVRQYVVR--KPLNK-EGKKPRTKAPKIQRLVTPRVL
FUG10007|RPS6        VRGCIVDANLSVLNLVIVKKGEKDIPGLT--DTTVPRRLGPKRASKIRKLFNLA------KEDDVRQYVVR--RPLNK-EGKKPRTKAPRIQRLVTPRVL
DAN10007|Rps6        VRGCIVDANLSVLNLVIVRKGEKDIPGLT--DSTVPRRLGPKRASRIRKLFNLS------KEDDVRQYVVR--RPLTK-EGKKPRTKAPKIQRLVTPRVL
MED10007|Rps6        VRGCIVDANLSVLNLVIIKKGEKDIPGLT--DSTVPRRLGPKRASKIRKLFNLA------KEDDVRQYVVR--RPLTK-EGKKPRTKAPKIQRLVTPRVL
CIO10007|RPS6        VRGCIVDAGLSVLSLVIVKRGEKEIPGLT--DNTIPKRLGPKRASKIRKLFMLG------PDDDVRKYVVR--RPLPAKEGKPPKTKAPKIQRLVTPQSV
DRO10009|RpS6        VRGCIVDANMSVLALVVLKKGEKDIPGLT--DTTIPRRLGPKRASKIRKLYNLS------KEDDVRRFVVR--RPLPAKDNKKATSKAPKIQRLITPVVL
MOS10007|Rps6        VRGCIVDQNLSALALVIVRKGEKDIPGLT--DVNVPRRLGPKRASNIRKLYNLS------KEDDVRHYVVK--RPLPVKEGQKPRFKSPKIQRLITPVVL
BEE10007|Rps6        VRGCIVDSNLSVLALVIVKKGEKDIPDLT--DKDVPRRLGPKRASKIRKLFNLS------KEDDVRRFVVK--RPIQK-EGKPARSKAPKIQRLITPLTL
CEL10007|rps-6       VRGCIVDANMSALSLVIVKKGDGEIEGLT--DSVLPRKLGPKRASKIRKLFNLT------KHDDVTKYVIT--HDKTFPDG-VTKTIAPKIQRLITPARI
BMA10007|RPS6        VRGCIVDANLSALALIIVKKGEQEIPGLT--DTTVPRRLGPKRASKIRKLFNLT------KNDDVRKYVIR--RKLPEKEGKKPRSKAPKIQRLITPVVL
STE10007|RPS6        VRGCIVDSQLSVLSLVIVKKGEQDIPGLT--DNTIPRRLGPKRVGKIRKMFNLS------KEDDVRQYVIR--RPLPEKEGKKAKSKAPKIQRLVTPVVL
MBR10007|RPS6        ARGCIVDSNLSVIACIIVQKGEKEIEGLT--DVTRPRRLGPKRANNIRKLFNLT------KEDDVRKYVIR--RKIEK-DGKVVNTKAPKIQRLITPERL
NEU10007|Rps6        VRGCIVGSDLSVLALAIVKQGEQDIPGLT--DVVHPKRLGPKRATKIRRFFGLS------KDDDVRKYVIRREVQ-PKGEGKKPYTKAPKIQRLVTPQRL
GRI10007|Rps6        VRGCITGMDLSVLAVSIAKRGEQDIPGLT--DVVHPKRLGPKRATKIRKFFDLS------KEDDVRKYVIRREVQ-PKGEGKKPYTKAPKIQRLVTPQRL
GRA10007|Rps6        VRGCIVAMDLSVLALSIVKQGDADIPGLT--DVVHPKRLGPKRATKIRKFFGLT------KDDDVRKYVIRREVQ-PKGEGKSPYTKAPRIQRLVTPQRL
STA10007|Rps6        VRGCIVGMDLSVLALSIVKKGDNDIPGLT--DVVHPKRLGPKRATKIRRFFGLS------KEDDVRKFVIRREVT-GKKEGAKPYTKAPKIQRLVTPQRL
YAR10007|Rps6        VRGCIVSSDLSVLSVVIVKQGDADIEGLT--TETVPRRLGPKRANNIRKLFALS------KEDDVRQYVIRREVT-TKSG--KTYTKAPKIQRLITPRRL
POM10012|RPS6-1      VRGCIVGQDLAVLALAIIKQGEQDIPGLT--DVTVPKRLGPKRASKIRRFFNLS------KEDDVRQFVIRREVV-PKKEGKKPYTKAPKIQRLVTPRTL
POM10013|RPS6-2      VRGCIVGQDLAVLALAIVKQGEQDIPGLT--DVTVPKRLGPKRASKIRRFFNLS------KEDDVRQFVIRREVV-PKKEGKKPYTKAPKIQRLVTPRTL
YST10010|RPS6A       VRGAIVGPDLAVLALVIVKKGEQELEGLT--DTTVPKRLGPKRANNIRKFFGLS------KEDDVRDFVIRREVT-KGE---KTYTKAPKIQRLVTPQRL
YST10011|RPS6B       VRGAIVGPDLAVLALVIVKKGEQELEGLT--DTTVPKRLGPKRANNIRKFFGLS------KEDDVRDFVIRREVT-KGE---KTYTKAPKIQRLVTPQRL
CIN10007|Rps6        VRGCIVGPEIAVLSLVIVKQGEQEIPGLT--DVVLPKRLGPKRATKIRRFFNLS------KEDDVRKYVVRREVKSAKNPDAKPYTKAPKIQRLVTPLRL
NEA10007|Rps6        VRGCIVGSDIGVLAVAIVKQGANELPGLT--DVVLPKRLGPKRATKIRKFFNLS------KEDDVTKFVVRREVTKKNG---KTTTKAPKIQRLVTPLRL
MAY10007|Rps6        VRGCIVGPDIQALHLIVVKQGEKEIPGLTDAESTVPKRLGPKRANHIRKFFNLS------KEDDVRQFVVRREVVSKKE-GAKPYTKAPKIQRLVTAQRL
RHI10026|Rps6        VRGCIVGSDLSVLSLVVVKQGEQDIPGLT--DTTVPKRLGPKRASKIRRFFNLS------KEDDVRKYVIRREVQ-PKAEGKKAYTKAPKIQRLVTPRTL
RHI10027|Rps6-2      VRGCIVGSDLSVLSLVVVKQGEQDIPGLT--DTTVPKRLGPKRASKIRRFFNLS------KEDDVRKYVIRREVQ-PKAEGKKAYTKAPKIQRLVTPRTL
RHI10028|Rps6-3      VRGCIVGSDLSVLSLVVVKQGEQDIPGLT--DTTVPKRLGPKRASKIRRFFNLS------KEDDVRKYVIRREVQ-PKTEGKKAYTKAPKIQRLVTPRTL
RHI10029|Rps6-4      VRGCIVGSDLSVLSLVVVKQGEQDIPGLT--DTTVPKRLGPKRASKIRRFFNLS------KEDDVRKYVIRREVQ-PKTEGKKAYTKAPKIQRLVTPRTL
RHI10030|Rps6-5      VRGCIVGSDLSVLSLVVVKQGEQDIPGLT--DTTVPKRLGPKRASKIRRFFNLS------KEDDVRKYVIRREVQ-PKTEGKKAYTKAPKIQRLVTPRTL
ARA10017|RPS6A       VRGCIVSPDLSVLNLVIVKKGENDLPGLT--DTEKPRMRGPKRASKIRKLFNLK------KEDDVRTYVNTYRRKFTNKKGKEVSKA-PKIQRLVTPLTL
ARA10018|RPS6B       VRGCIVSPDLSVLNLVIVKKGVSDLPGLT--DTEKPRMRGPKRASKIRKLFNLG------KEDDVRKYVNTYRRTFTNKKGKKVSKA-PKIQRLVTPLTL
RIC10018|RPS6A       VRGCIVSQDLSVINLVIVKKGENDLPGLT--DTEKPRMRGPKRASKIRKLFNLS------KDDDVRKYVNTYRRTFTTKNGKKVSKA-PKIQRLVTPLTL
RIC10019|RPS6B       VRGCIVSQDLSVINLVIVKKGDNDLPGLT--DTEKPRMRGPKRASKIRKLFNLA------KDDDVRKYVNTYRRTFTTKNGKKVSKA-PKIQRLVTPLTL
GMA10031|LOC10078655 VRGCIVSPDLSVLNLVIVKKGESDLPGLT--DVEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRTFTTKAGKKVSKA-PKIQRLVTPLTL
GMA10032|LOC10080407 VRGCIVSPDLSVLNLVIVKKGENDLPGLT--DVEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRTFTTKAGKKVSKA-PKIQRLVTPLTL
GMA10034|RPS6        VRGCIVSPDLSVLNLVIVKKGENDLPGLT--DAEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRTFTTKAGKKVSKA-PKIQRLVTPLTL
GMA10035|LOC10080119 VRGCIVSPDLSVLNLVIVKKGENDLPGLT--DVEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRTFTTKNGKKVSKA-PKIQRLVTPLTL
GMA10036|LOC10080050 VRGCIVSPDLSVLNLVIVKKGESDLPGLT--DVEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRTFTTKNGKKVSKA-PKIQRLVTPLTL
GMA10037|LOC10081969 VRGCIVSPDLSVLNLVIVKKGESDLPGLT--DVEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRTFITKAGKKVSKA-PKIQRLVTPLTL
GMA10038|LOC10079294 VRGCIVSPDLSVLNLVIVKKGESDLPRLT--DVEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRTFTTKVGKKVSKA-PKIQRLVTPLTL
POP10007|RPS6        VRGCIVSQDLSVLNLVIVKKGENDLPGLT--DTEKPRMRGPKRASKIRKLFNLS------KEDDVRKYVNTYRRSFTTKAGKKVSKA-PKIQRLVTPLTL
CRE10007|RPS6        VRGCIVSPDLAVLNLVIVKKGEQELPGLT--DEEKPRIRGPKRASKIRKMFNLG------KVDDVRKYVTIYSRERTDKNGKKHRKC-PKIQRLVTPAAL
VOL10008|RPS6        VRGCIVSPDLSVLNLVIVKKGEAELPGLT--DEEKPRMRGPKRASKIRKMFNLS------KEDDVRKYVTIYSRERKDKNGKTHRKC-PKIQRLVTPAAL
HEM10007|rps6        VRGCFVSPEIAVLNLSIIKEGK-EINGLT--DSKMKTKIGPKRASKIRKIFRLS------KGNDLRKYIIQNKKD-------EKKPG-QKIQRIITPLSL
PTR10007|RPS6        VRGCVVGADIAVLNLVITQIGPNTVPGLT--DDQIPRRLGPKRANNIRKLFNLT------KEDDVRKYV--IARTFTNKKGVTVRKS-PKIQRLVTPLTL
TPS10007|Rps6        IRGCIVSHDIAVLNLCVVKAGDNPIAGLT--DDSVPRRLGPKRANKIRALFNLT------RDDDVRKYV--ISRTFTNKKGKTVRKA-PKIQRLVTPLVL
CYA10007|RPS6        VRGCIISSEMSVVNLAIVRQGEQEIPGLT--DRIIPRRLGPKRASKIRKLFNLS------KDDDVRKYV--IRRKVTTASGKTYEKA-PKIQRLVTAQSL
DIC10007|RPS6        VRGCIVAEDIASLQLIIVKKGDAEIPGLT--DVSFPASKGPKRASNIRKLFKLS------KDEDVRSFVIR--RELPATDKRKAKSKAPKIQRLVTPTTV
PLA10007|RPS6        VRGCIVGQDLSALNLTLVKKGVNEIPGLT--DKAVGKKLGPKRASKIRKLFNLD------KSDDVRKYVIGR----AITKNGKTKFIKPKIQRLVTEKRL
TGO10007|RPS6        VRGSIVGPDLAVLNLVLVKKGPETIPGLT--DAERPRRLGPKRANNIRKLFNLS------KDQDVRKYVVRR----QIE--GKKKTKAPKIQRLITKTRV
GIA10007|Rps6        IRGCIVGPDLHALSVVLVDAGDKTLPGLT--DVVVPKRLVPKRASKIRRLFGLPTTKVDPKDQMLVCELIKELGHEVTLKNGEKKLKYPKVQRVVTDEKY
HAL10035|VNG2514G    VRGKEVSEAVAQLNVAIDEHGEEPVAELLGADGDDE----------------------------------------------------------------
MET10007|MJ1260      VRGNTIAPDIVQINVKVVEYGEKSIPELLGLEGGENQEQ-------------------------------------------------------------
PYR10038|PH0615      VRGNTISPEIVQVNVKLVY---------------------------------------------------------------------------------
SUL10040|ST0382      VRGNMITQDIVQINTIIIR---------------------------------------------------------------------------------


HUM10008|RPS6        QHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
DOG10007|Rps6        QHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
MUS10007|Rps6        QHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
RAT10007|Rps6        QHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
CHK10007|Rps6        QHKRRRIALKKQRTQKNKEEAADYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
FUG10007|RPS6        QHKRRRIALKRKRTQKNKEEASEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
DAN10007|Rps6        QHKRRRIALKRQRTLKNKEAAAEYTKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
MED10007|Rps6        QHKRRRIALKKQRTQKNKEEASEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK------------------------------------
CIO10007|RPS6        QRKRHRIAIKRRRTERGLQEEAEYKKLLAKRLKEQKEKK-AEAHKKRRLSSLRASQSQSVSSQ-------------------------------------
DRO10009|RpS6        QRKHRRIALKKKRQIASKEASADYAKLLVQRKKESKAKR-EEAKRRRSASIRESKSSVSSDKK-------------------------------------
MOS10007|Rps6        QRKRHRLLIKKRRSEARREAESQYSRLLALRRRQERVRRHSRLSSIRDSRSSLTSEKDKKSLAAAKKKEAASKKEAAAPKKEAAPAKKAAVAKKDAGKKD
BEE10007|Rps6        QRKRHRLALKRRRSLARKQQAAEYAKLLAQRQKEAKNRRQEELKRRRSASMRDSKSSSQSAPTTQK----------------------------------
CEL10007|rps-6       ARKKYLLRQKRNQKIKMRDDAAAYHKLLAKYSKE---EHDAKIARRRSSASHHSESEVKKTSKK------------------------------------
BMA10007|RPS6        QRKRRRLAMKIKRSVKRREEEAQYHKMMTQYSKE---KQAAKIARRRSSASRRESESARYSKSSK-----------------------------------
STE10007|RPS6        QRKRKRLALKRQRAQKCKQEAADYAKLLAKRAKEAKEKRHEQLMKKRRASSLRDSVSAK-----------------------------------------
MBR10007|RPS6        QRKRCELAQKRANRAHQNQLKAEYSEMLAKLQKERADARAALHQKRRISSRKSESKSESKA---------------------------------------
NEU10007|Rps6        QHKRHRLALKRRQAEKVKEEASEYAQILAKRIAEAKVQKADARKRRASSMRK------------------------------------------------
GRI10007|Rps6        QHKRHRIALKKRQSEKVKDAANEYAQILAKRVAEAKATKADARKRRASSMRK------------------------------------------------
GRA10007|Rps6        QHKRHRAALKRRQAEKVKDEANEYAQVLAKRIAEAKVNKADARKRRASSMRK------------------------------------------------
STA10007|Rps6        QHKRHRIALKRRRAEASKDAANEYAQILQKRLGQAKAAHDEARKRRASSMRH------------------------------------------------
YAR10007|Rps6        AHKAQLREKKVKAIQASKDAAAEYAQLLAKRVAEKKSEKAEEKKRRASSLRTQSVQA-------------------------------------------
POM10012|RPS6-1      QHKRHRFALKRRQAEKNREEAAEFAQLMAKRVAEAKQKREVVKARRASSLKK------------------------------------------------
POM10013|RPS6-2      QHKRHRFALKRRQAEKNREEAAEFAQLMAKRVAEAKQKKEVVKARRASSMKK------------------------------------------------
YST10010|RPS6A       QRKRHQRALKVRNAQAQREAAAEYAQLLAKRLSERKAEKAEIRKRRASSLKA------------------------------------------------
YST10011|RPS6B       QRKRHQRALKVRNAQAQREAAAEYAQLLAKRLSERKAEKAEIRKRRASSLKA------------------------------------------------
CIN10007|Rps6        QRRRHLNAIKRHRIERQKEQKAEYDALLAKRLAEKKAKVAAIKAAHKTA---------------------------------------------------
NEA10007|Rps6        QRKRHLRSLKKRRTEAQKETVAEYNAAVAKHAEERKVHNAAVKAAKKARRSA------------------------------------------------
MAY10007|Rps6        QRKRHLRSLKIRKAEAQKIQKEEYEQVLAKRVAEKKQEVAAHKAARKSAKKVQA----------------------------------------------
RHI10026|Rps6        QHKRRRQAIKRRRAESSREAEAEYKQLLAKRVKEAKDKK--IERRRTSSMQKSSSA--------------------------------------------
RHI10027|Rps6-2      QHKRRRQAIKRRRAESSREAEAEYKQLLAKRVKEAKDKK--IERRRTSSMQKSSA---------------------------------------------
RHI10028|Rps6-3      QHKRRRQAIKRRRAESSREAEAEYKQLLAKRVKEAKDKK--IERRRTSSMQKSASA--------------------------------------------
RHI10029|Rps6-4      QHKRRRQAIKRRRTEASREAEAEYKQLLAKRVKEAKDKK--IERRRTSSMQKSASA--------------------------------------------
RHI10030|Rps6-5      QHKRRRQAIKRRRAESSREAEAEYKQLLAKRVKEAKDKK--IERRRTSSMQKSASA--------------------------------------------
ARA10017|RPS6A       QRKRARIADKKKKIAKANSDAADYQKLLASRLKEQRDRRSESLAKKRSRLSSAAAKPSVTA---------------------------------------
ARA10018|RPS6B       QRKRARIADKKKRIAKANSDAADYQKLLASRLKEQRDRRSESLAKKRSRLSSAPAKPVAA----------------------------------------
RIC10018|RPS6A       QRKRARIADKKKRIAKKKSEAAEYQKLLAQRLKEQRERRSESLAKRRSKLSSAAKAAATTA---------------------------------------
RIC10019|RPS6B       QRKRARIAQKKQRIAKKKSEAAEYQKLLAQRLKEQRERRSESLAKRRSKLSAATTA--------------------------------------------
GMA10031|LOC10078655 QRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSAAKPTVTA----------------------------------------
GMA10032|LOC10080407 QRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSAAKAAAV-----------------------------------------
GMA10034|RPS6        QRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSAAKAAV------------------------------------------
GMA10035|LOC10080119 QRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSATKQAATA----------------------------------------
GMA10036|LOC10080050 QRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSAAKQAATA----------------------------------------
GMA10037|LOC10081969 QRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSAAKPTASA----------------------------------------
GMA10038|LOC10079294 QRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKRRSKLSSAAKQAATA----------------------------------------
POP10007|RPS6        QRKRARISDKKKRIAKAKSEAAEYQKLLATRLKEQRDRRSESLAKKRSRLSIASKPSIVA----------------------------------------
CRE10007|RPS6        QRKRARKSLKKRQQEKNKTDAAEYHKLLMQRLKEQRERRSESLAKKRAMRVASQASKEA-----------------------------------------
VOL10008|RPS6        QRKRARKILKKRQQEKNKTEAAEYHKLLMQRLKEQRERRWVLLGSRVKALLGVLRESWARMKGGLSSARS------------------------------
HEM10007|rps6        QRKRFFHSVKKKKIINTKNKLQEYGKMLFLNN--------------------------------------------------------------------
PTR10007|RPS6        QRKRARKAEKMSSVLRSKDEAAAYKKVVAQRMAEAREVRRSLISKRRSSRKSAKMAAETS----------------------------------------
TPS10007|Rps6        QRKRARKAAKLASVLRNKEETAAYKKVCAQRLAEQKEARRSLISKRRSTRKSAKLAAE------------------------------------------
CYA10007|RPS6        QRKRRRRAVQRTRALKAKAEAAEYEKLLAQRQAEARQSRKESRSRRSALHKSRLSAAV------------------------------------------
DIC10007|RPS6        ARRKALRAKKAARHTKASNEAAEYAKLVAQRQQAKAKRSVKVSSKKVVAK--------------------------------------------------
PLA10007|RPS6        LRKRNLLQAKEKRRLEKKQQLKEYKQLLNKYRSELNQQHDEQAKKKTKTNENTQQTKQNKPDKKNKAKK-------------------------------
TGO10007|RPS6        QRKRAYLAKQRRSVIKSREEAKAYKDVLSAYKHELRKKRADVVAKKKAQAAAAPKPAEVKVVKAKAATAKKGGK--------------------------
GIA10007|Rps6        ARKQRVIAEKKEIMRKSLQQLEEYKALLSRMGKQHNIRIYKPAKRTVE----------------------------------------------------
HAL10035|VNG2514G    ----------------------------------------------------------------------------------------------------
MET10007|MJ1260      ----------------------------------------------------------------------------------------------------
PYR10038|PH0615      ----------------------------------------------------------------------------------------------------
SUL10040|ST0382      ----------------------------------------------------------------------------------------------------


HUM10008|RPS6        ----------------------------------------------------------------------------------------------------
DOG10007|Rps6        ----------------------------------------------------------------------------------------------------
MUS10007|Rps6        ----------------------------------------------------------------------------------------------------
RAT10007|Rps6        ----------------------------------------------------------------------------------------------------
CHK10007|Rps6        ----------------------------------------------------------------------------------------------------
FUG10007|RPS6        ----------------------------------------------------------------------------------------------------
DAN10007|Rps6        ----------------------------------------------------------------------------------------------------
MED10007|Rps6        ----------------------------------------------------------------------------------------------------
CIO10007|RPS6        ----------------------------------------------------------------------------------------------------
DRO10009|RpS6        ----------------------------------------------------------------------------------------------------
MOS10007|Rps6        AAKKTVAKKEVKKDGKKEVKKDAAKKDAGKKEVKKDAPKKDAGKKEVKKDAGKKEEKKPAAASAPAGKKAAASSAKPEAAKKAAPKTEGKKPAAAAAEKK
BEE10007|Rps6        ----------------------------------------------------------------------------------------------------
CEL10007|rps-6       ----------------------------------------------------------------------------------------------------
BMA10007|RPS6        ----------------------------------------------------------------------------------------------------
STE10007|RPS6        ----------------------------------------------------------------------------------------------------
MBR10007|RPS6        ----------------------------------------------------------------------------------------------------
NEU10007|Rps6        ----------------------------------------------------------------------------------------------------
GRI10007|Rps6        ----------------------------------------------------------------------------------------------------
GRA10007|Rps6        ----------------------------------------------------------------------------------------------------
STA10007|Rps6        ----------------------------------------------------------------------------------------------------
YAR10007|Rps6        ----------------------------------------------------------------------------------------------------
POM10012|RPS6-1      ----------------------------------------------------------------------------------------------------
POM10013|RPS6-2      ----------------------------------------------------------------------------------------------------
YST10010|RPS6A       ----------------------------------------------------------------------------------------------------
YST10011|RPS6B       ----------------------------------------------------------------------------------------------------
CIN10007|Rps6        ----------------------------------------------------------------------------------------------------
NEA10007|Rps6        ----------------------------------------------------------------------------------------------------
MAY10007|Rps6        ----------------------------------------------------------------------------------------------------
RHI10026|Rps6        ----------------------------------------------------------------------------------------------------
RHI10027|Rps6-2      ----------------------------------------------------------------------------------------------------
RHI10028|Rps6-3      ----------------------------------------------------------------------------------------------------
RHI10029|Rps6-4      ----------------------------------------------------------------------------------------------------
RHI10030|Rps6-5      ----------------------------------------------------------------------------------------------------
ARA10017|RPS6A       ----------------------------------------------------------------------------------------------------
ARA10018|RPS6B       ----------------------------------------------------------------------------------------------------
RIC10018|RPS6A       ----------------------------------------------------------------------------------------------------
RIC10019|RPS6B       ----------------------------------------------------------------------------------------------------
GMA10031|LOC10078655 ----------------------------------------------------------------------------------------------------
GMA10032|LOC10080407 ----------------------------------------------------------------------------------------------------
GMA10034|RPS6        ----------------------------------------------------------------------------------------------------
GMA10035|LOC10080119 ----------------------------------------------------------------------------------------------------
GMA10036|LOC10080050 ----------------------------------------------------------------------------------------------------
GMA10037|LOC10081969 ----------------------------------------------------------------------------------------------------
GMA10038|LOC10079294 ----------------------------------------------------------------------------------------------------
POP10007|RPS6        ----------------------------------------------------------------------------------------------------
CRE10007|RPS6        ----------------------------------------------------------------------------------------------------
VOL10008|RPS6        ----------------------------------------------------------------------------------------------------
HEM10007|rps6        ----------------------------------------------------------------------------------------------------
PTR10007|RPS6        ----------------------------------------------------------------------------------------------------
TPS10007|Rps6        ----------------------------------------------------------------------------------------------------
CYA10007|RPS6        ----------------------------------------------------------------------------------------------------
DIC10007|RPS6        ----------------------------------------------------------------------------------------------------
PLA10007|RPS6        ----------------------------------------------------------------------------------------------------
TGO10007|RPS6        ----------------------------------------------------------------------------------------------------
GIA10007|Rps6        ----------------------------------------------------------------------------------------------------
HAL10035|VNG2514G    ----------------------------------------------------------------------------------------------------
MET10007|MJ1260      ----------------------------------------------------------------------------------------------------
PYR10038|PH0615      ----------------------------------------------------------------------------------------------------
SUL10040|ST0382      ----------------------------------------------------------------------------------------------------


HUM10008|RPS6        ------------------------------------------------
DOG10007|Rps6        ------------------------------------------------
MUS10007|Rps6        ------------------------------------------------
RAT10007|Rps6        ------------------------------------------------
CHK10007|Rps6        ------------------------------------------------
FUG10007|RPS6        ------------------------------------------------
DAN10007|Rps6        ------------------------------------------------
MED10007|Rps6        ------------------------------------------------
CIO10007|RPS6        ------------------------------------------------
DRO10009|RpS6        ------------------------------------------------
MOS10007|Rps6        PAKKETAAPAAAGAKKEAPKRKPEPAAQQKGEASAAKKEKKQQQPKKK
BEE10007|Rps6        ------------------------------------------------
CEL10007|rps-6       ------------------------------------------------
BMA10007|RPS6        ------------------------------------------------
STE10007|RPS6        ------------------------------------------------
MBR10007|RPS6        ------------------------------------------------
NEU10007|Rps6        ------------------------------------------------
GRI10007|Rps6        ------------------------------------------------
GRA10007|Rps6        ------------------------------------------------
STA10007|Rps6        ------------------------------------------------
YAR10007|Rps6        ------------------------------------------------
POM10012|RPS6-1      ------------------------------------------------
POM10013|RPS6-2      ------------------------------------------------
YST10010|RPS6A       ------------------------------------------------
YST10011|RPS6B       ------------------------------------------------
CIN10007|Rps6        ------------------------------------------------
NEA10007|Rps6        ------------------------------------------------
MAY10007|Rps6        ------------------------------------------------
RHI10026|Rps6        ------------------------------------------------
RHI10027|Rps6-2      ------------------------------------------------
RHI10028|Rps6-3      ------------------------------------------------
RHI10029|Rps6-4      ------------------------------------------------
RHI10030|Rps6-5      ------------------------------------------------
ARA10017|RPS6A       ------------------------------------------------
ARA10018|RPS6B       ------------------------------------------------
RIC10018|RPS6A       ------------------------------------------------
RIC10019|RPS6B       ------------------------------------------------
GMA10031|LOC10078655 ------------------------------------------------
GMA10032|LOC10080407 ------------------------------------------------
GMA10034|RPS6        ------------------------------------------------
GMA10035|LOC10080119 ------------------------------------------------
GMA10036|LOC10080050 ------------------------------------------------
GMA10037|LOC10081969 ------------------------------------------------
GMA10038|LOC10079294 ------------------------------------------------
POP10007|RPS6        ------------------------------------------------
CRE10007|RPS6        ------------------------------------------------
VOL10008|RPS6        ------------------------------------------------
HEM10007|rps6        ------------------------------------------------
PTR10007|RPS6        ------------------------------------------------
TPS10007|Rps6        ------------------------------------------------
CYA10007|RPS6        ------------------------------------------------
DIC10007|RPS6        ------------------------------------------------
PLA10007|RPS6        ------------------------------------------------
TGO10007|RPS6        ------------------------------------------------
GIA10007|Rps6        ------------------------------------------------
HAL10035|VNG2514G    ------------------------------------------------
MET10007|MJ1260      ------------------------------------------------
PYR10038|PH0615      ------------------------------------------------
SUL10040|ST0382      ------------------------------------------------