CLUSTAL W (2.1) Multiple Sequence Alignments
THE10006|TTHA0245    --MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
SYN10007|sll1767     VLVNSYELMVILRPDLNEERVSQEVTKYQEFLTNNAAEEVSVKVWGKRRLAYQIRRFNDGIYVLFNFNGEGQQIALIERDMRLNDNVMRFLSIKLTPEKP
BAC10006|Bsu4088     --MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFYQIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE---
ECO10006|rpsF        --MRHYEIVFMVHPDQSE-QVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVT


THE10006|TTHA0245    ANA-------------------------------
SYN10007|sll1767     EKEKKAKAVAVEA---------------------
BAC10006|Bsu4088     ----------------------------------
ECO10006|rpsF        EASPMVKAKDERRERRDDFANETADDAEAGDSEE