CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10005|VNG2657G    MSDEQPAEDETEEAAAESEDTQEVAANAKLFGKWDVAEIHYEDPSTRRYLAVTP--VAHTMGRHAQKQFKKSEISIVERLANRLMKTG------------
MET10008|MJ1047      ----------------------LELDEIKVFGRWSTKDVVVKDPGLRNYINLTPIYVPHTAGRYTKRQFEKAKMNIVERLVNKVMR--------------
PYR10005|PH1541      ----------VKEVAKPLQERFFIPHEIKVMGRWSTEDVEVKDPSLKPYINLEPRLLPHTHGRHAKKHFGKANVHIVERLINKVMRSGGSHYKVAGHFMR
THE10007|TTHA1696    ------------------------------------------------------MARRRRAEVRQLQPDLVYGDVLVTAFINKIMR--------------
SYN10008|sll1097     ------------------------------------------------------MSRRGNVKKRPVPPDPVYNSTLLSMTIRRVMR--------------
BAC10007|Bsu0111     ------------------------------------------------------MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMI--------------
ECO10007|rpsG        ------------------------------------------------------MPRRRVIGQRKILPDPKFGSELLAKFVNILMV--------------
SUL10005|ST0270      -----------------MESFEVSSIDLKVFGKWDTK-VEIRDPSLKKYIGLMPVYLPHTGGRHEHRRFGKAKLPIVERLINNVMR--------------


HAL10005|VNG2657G    ----ANAGKKQQALKIVRDAFDIVHERTDENPIQVLVSAVENAAPREETVRLKYGGISVPQAVDTAPQRRVDQALKFLADGAHSASFKTPTDAAEALANQ
MET10008|MJ1047      --REENTGKKLKALKIVENAFEIIEKRTKQNPIQVLVDAIENAGPREDTTRISYGGIVYLQSVDCSSLRRIDVALRNIALGAYMAAHKSKKPIEEALAEE
PYR10005|PH1541      REHRSLNSKKVRAYEVVKEAFKIIEKRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVDISPLRRLDVALRNIALGASAKCYRTKMSFAEALAEE
THE10007|TTHA1696    ------DGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERR---AAVRIAHE
SYN10008|sll1097     ------SGKKSLASSIVYNALASVGEKTGEDPLEVFEKAIKNLTPLVEVKARRVGGATYQVPMEVRPARGTALALRWLVHFSRARGGRT---MESKLANE
BAC10007|Bsu0111     ------DGKKGKPQTILYKSFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKT---MEERLANE
ECO10007|rpsG        ------DGKKSTAESIVYSALETLAQRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKS---MALRLANE
SUL10005|ST0270      --PGRNKGKKMLAYNIVKTAFDIIALKTGQNPIQVLVKAIENSAPREEVTRIMYGGIVYYVAVDVAPQRRVDLALRHLVMGAKEASFNNPKPIEEALAEE


HAL10005|VNG2657G    LAGAAD-YNVQTYAIGQKKEKERVAAAAR------------------------------
MET10008|MJ1047      IIAAARGDMQKSYAVRKKEETERVAQSAR------------------------------
PYR10005|PH1541      IILAAN-KDPKSYAYSKKLEIERIAESSR------------------------------
THE10007|TTHA1696    LMDAAE---GKGGAVKKKEDVERMAEANRAYAHYRW-----------------------
SYN10008|sll1097     IMDAAN---ETGAAIKKREETHRMAEANKAFAHYRY-----------------------
BAC10007|Bsu0111     ILDAAN---NTGAAVKKREDTHKMAEANKAFAHYRW-----------------------
ECO10007|rpsG        LSDAAE---NKGTAVKKREDVHRMAEANKAFAHYRWLSLRSFSHQAGASSKQPALGYLN
SUL10005|ST0270      IIAAAS-NDPKSFAIRKKEEIERIALSSR------------------------------