CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10010|RPS8        MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIG---------PRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELV
DOG10009|Rps8        MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIG---------PRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELV
MUS10009|Rps8        MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIG---------PRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELV
RAT10009|Rps8        MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIG---------PRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELV
CHK10009|Rps8        MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPPANTKIG---------PRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELV
FUG10009|RPS8        MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPPANTKLG---------PRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELV
DAN10009|Rps8        MGISRDNWHKRRRTGGKRKPVHKKRKYELGRPAANTKIG---------PRRIHTIRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELV
MED10009|Rps8        MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPPANTKIG---------PRRIHTVRVRGGNKKYRALRLDSGNFSWGSECCTRKTRIIDVVYNASNNELV
CIO10009|RPS8        MGISQDSWHKRRATGGKRPQPRKKRKFELGRPAANTKIG---------AKRVHLVRTRGGNTKFRGLRLDTGNFSWGSEACARKTRIIDVMYNASNNELL
DRO10011|RpS8        MGISRDSAHKRRATGGKRKSLRKKRKFELGRPAANTKLG---------SGRVHKVRTRGGNTKLRALRLETGNFAWASEGVARKTRIADVVYNASNNELV
MOS10009|Rps8        MGISRDSYHKRRATGGKKAAIRKKRKYELGRPAANTKIG---------ATRVHFVRTRGGNRKFRALRLDSGNFAWGSEGMARKARIIDVVYNASNNELI
BEE10009|Rps8        MGISRDHWHKRRATGGKRKPIRKKRKFELGRPAANTKLG---------PQRIHTVRTRGGNKKYRALRLDTGNFSWGSECTTRKTRIIDVVYNASNNELV
CEL10009|rps-8       MGISRDSWHKRYKTGATQPVPHKKRKFELGRPAANTKIG---------AHRVRLVRTRGGNEKYRALRLDSGNFSWASEQTTRKTRIVDTMYNATNNELV
BMA10009|RPS8        MGISRDNWHKRRATGGKRCPPHKKRKFELGRPASNTKIG---------PKRIHLVRCRGGNIKHRALRLDVGTFSWGSEGCTRKTRIVDTVYNASNNELV
STE10009|RPS8        MGISRDSWHKHRATGGKMKPLRKKRKFELGRPPANTKIG---------TKRIHEVRTRGGNRKFRALRLDTGNFSWGSESCTRKARIIDVVYNASNNELV
MBR10009|RPS8        MGISRDKFHKRRRTGARVAPIRMKRKYELGRPPALTKLAG--------PKRVHEIRTMGGNRKFRALRLETGNFSWGSEGVSRKTRLIDVVYNASNNELV
NEU10009|Rps8        MGISRDSRHKRSHTGAKRAYYRKKRAFEAGRQPANTRIGA---------KRIHTVRTRGGNHKYRALRLDSGNFAWASEGCTRKTRVIVVAYHPSNNELV
GRA10009|Rps8        MGISRDSRHKRSASGAKRAYYRKKRAFEAGRQGANTRIGP---------KRVHTVRTRGGNHKYRALRLDSGNFAWGSEGLTRKTRVIAVAYHPSNNELV
STA10009|Rps8        MGISRDSRHKRSASGAKRAYYRKKRAFEKGRQPANTRIGA---------KRVHLVRTRGGNRKFRALRLDSGNFSWGSEGIAKKTRVIGVVYHPSNNELV
YAR10009|Rps8        MGISRDSRHKRSHTGAKRVSIHKKRKFECGRQGAVTRIGP---------KRIHTVRTRGGNKKFRAIRIETGNFSWGSEGTTRKTRVLGVSFHPSNNELI
POM10015|RPS8-1      MGITRDSRHKRSATGAKRAQYRKKRKFELGRQPSNTRIGP---------KRIHEVRVRGGNKKFRALRLDSGNFSWGSEGVSKKTRIIQVAYHPSNNELV
POM10016|RPS8-2      MGITRDSRHKRSATGAKRAQYRKKRKFELGRQPSNTRIGP---------KRIHEVRVRGGNKKFRALRLDSGNFSWGSEGVSKKTRIIQVAYHPSNNELV
YST10014|RPS8A       MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGA---------KRIHSVRTRGGNKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELV
YST10015|RPS8B       MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGA---------KRIHSVRTRGGNKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELV
CIN10009|Rps8        MGISRSSRHKRSETGAQRAHYRKKRKFELGRQPANTKLGP---------KRIHTVRGRGGNLKYRALRLETGNFAWGSESITRKTRLIGVVYNSSNNELV
NEA10009|Rps8        MGITRDSRHKRAASGARRAHYRKKRKFELGRQPAMTKLDS--------SKRIHEVRTRGGNVKYRALRLDSGNFAWGSESITRKTRLIQVRYNATNNELL
MAY10009|Rps8        MGITRDSRHKRSATGARRAYYRKKRAFELGRQAANTRIGA---------KRIHTVRVRGGNLKHRALRLESGNFAWGSEHITAKTRVLGVVYNASNNELV
RHI10035|Rps8        MGISRDSRHKRSATGARRAQYRKKRKFELGRQSANTKLGS---------KRIHLVRVRGGNFKRRALRLENGNFSWGSEGISRKTRVLTVVYNASNNELV
RHI10036|Rps8-2      MGISRDSRHKRSATGARRAQYRKKRKFELGRQSANTKLGS---------KRIHLVRVRGGNFKRRALRLENGNFSWGSEGISRKTRVLTVVYNASNNELV
RHI10037|Rps8-3      MGISRDSRHKRSATGARRAQYRKKRKFELGRQSANTKLGS---------KRIHLVRVRGGSFKRRALRLENGNFSWGSEGISRKTRVLTVVYNASNNELV
RHI10038|Rps8-4      MGISRDSRHKRSATGARRAQYRKKRKFELGRQSANTKLGS---------KRIHLVRVRGGSYKRRALRLENGNFSWGSEGISRKTRILTVVYNASNNELV
RHI10039|Rps8-5      MGISRDSRHKRSATGARRAQYRKKRKFELGRQSANTKLGS---------KRIHLVRVRGGNFKRRALRLENGNFSWGSEGISRKTRVLTVVYNASNNELV
ARA10022|RPS8A       MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSS--------NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEATTRKTRVLDVVYNASNNELV
ARA10023|RPS8B       MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSS--------NKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRILDVAYNASNNELV
RIC10023|RPS8A       MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSS--------NKTVRRVRVRGGNLKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV
GMA10045|LOC10080300 MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSS--------NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV
GMA10046|LOC10079493 MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS--------NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELV
GMA10047|LOC10081317 MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSS--------NKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV
GMA10048|LOC10052766 MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS--------NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV
GMA10049|LOC10052732 MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS--------NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAATRKTRILDVVYNASNNELV
POP10009|RPS8        MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSS--------NKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELV
CRE10009|RPS8        MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLST--------NVAVRTVRVRGGHTKFRALRLDTGNYSWGSEAVTRKVRILDVVYNASNNELV
VOL10010|RPS8        MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSS--------NVAVRTVRVRGGHTKFRALRLDTGNYSWGSEAVTRKVRILDVVYNASNNELV
HEM10008|rps8        MGISRDSIHKKRLTGGKKRIWRKKRKHEIGRQGANTKIG---------IKQIAKIRVRGGNVKNRALKLDHGNFSLISIAITKKTRILSVVYNSSNNELV
PTR10009|RPS8        MGITREGRHKRRETGGRRAKFRKKRKFELGRPAAMTKIG---------EPRIHPVRCRGGNMKFRALRLDSGNFSWGTEVCTRKVRVLDVTYNASNNELV
TPS10009|Rps8        MGITREGKHKRRETGGRRAQFRKKRKFELGRPAAMTKIG---------EKRIHTVRCRGGNLKFRALRLDSGNFSWGTEVCTRKVRVLDVVYNASNNELV
CYA10009|RPS8        MGISRDSIHKRRLTGGKRKIHRKKRKYELGRPPANTRLG---------PKLVRPLRVRGGHFKFRALRLEMGNYSWASECVTRKTRILGVVYNASNNELV
DIC10009|RPS8        MGISRDALHKHRLTGAARKCNYKKRKYELGRQAAKTKICSQGE-----EKRVRSIRVRGGHQKFRALRLDTGNFSWATEKITRKCRILNVVYNATSNDLV
PLA10009|RPS8        MGISRDGRHKLRLTGGKKKIHKKKRKYELGRPPSNTKLGS---------RQVHVVRGRGRNYKYRAIKLDSGSFSWPTFGISKNTRIIDVVYNASNNELV
TGO10009|RPS8        MGISRDRRHKHRRTGGRMPVHQKKRKFELGRPPAMTKLGP---------KRVRPVRCRGGNMKYRALRLDTGNYSWSSQKIAKKTRLLGVVYNASNNELV
GIA10009|Rps8        MGITHDKMYKRSKTGAVQGKWHKKRKYNLGRQPANTKLIVKVTSKKNEGQKISTIRCRGGNIKRRALRLSHGSFAWGSADISHKARILQVVYNSTSNELV
HAL10036|VNG1668G    --MQYQGRSKRSKTGARLRPRSKKSKSELGREPTETTVGEP---------RFRTVDVRGDAEKVRVLSTNVVNVAT--DSGAERATIEDVSANDANPNYA
MET10009|MJ0673      -MSVWQGRSRRKPTGGLYRPARKKRKYEMGREPIETHVAEEA-------FKIKKVRTRGGNLKVKVVRTGFANVLDPETGTCKKVKIITVRENKANIHYV
PYR10039|PH1103      -MAIWQGRSLKKPSGGRIVLARKKRKRELGREPSNTRVAEQ--------DKRKIIRTYGGNRKVRLTAAAYANVFD-KSGKGRKVRIIRVLENPANRQFA
SUL10041|ST0188      -MGYFQGNDFRKITGGKKGKHRDKRKFELGSPPTETKLSTEE-------LIEKER-GMGGNIKIRVKYATFANIYDPQEKVSKKAKILSVIETPANKEYA


HUM10010|RPS8        RTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKG--AKLTP--------EEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQ
DOG10009|Rps8        RTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKG--AKLTP--------EEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQ
MUS10009|Rps8        RTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKG--AKLTP--------EEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQ
RAT10009|Rps8        RTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKG--AKLTP--------EEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQ
CHK10009|Rps8        RTKTLVKNCIVLVDSTPYRQWYEAHYALPLGRKKG--AKLTP--------EEEEILNKKRSKKIQKKYDERKKNAKIASILEEQFQQGKLLACIASRPGQ
FUG10009|RPS8        RTKTLVKNCIILVDSLPFRQWYEAHYATPLGRKKG--AKLTP--------EEEEVLNKKRSKKTQKKYDERKKTAKISTLLEEQFQQGKLLACIASRPGQ
DAN10009|Rps8        RTKTLVKNCVVLVDSTPYRQWYESHYALPLGRKKG--AKLTP--------EEEEILNKKRSKKVQKKFTLRRKTAKISPLLEEQFLQGKLLACISSRPGQ
MED10009|Rps8        RTKTLVKNCVVLVDSLPFRQWYEAHYATPLGRKKG--AKLTP--------DEEEVLNKKRSKKTQKKYDERKKVAKISPLLEEQFLQGKLLACIASRPGQ
CIO10009|RPS8        RTKTLVKNAIIQIDSTPFRQWYEAHYTVPLGRKKS--AKLTE--------AEDEIMNRKRSKKTQKKYEERKKEPKVAQALEEQFNQGRILACISSRPGQ
DRO10011|RpS8        RTKTLVKNSIVVIDATPFRQWYEAHYVLPLGRKRNPKHAQKE--------DENDVLTKKRSEKVMKKYLERQKYGKVEQALEDQFTSGRILACISSRPGQ
MOS10009|Rps8        RTKTLVKNAIIVIDASPFRQWYESHYLLPLGKKRE----LKA--------GEEDVLSKKRSKSNLRKYVKRQKNAKIDPAVEEQFNAGRLLACISSRPGQ
BEE10009|Rps8        RTKTLVKNAIVTIDATPFRQWYEGHYVLPLGRKRG--AKLTE--------AEEEVLNKKRSKKAEAKYKARQRFAKVEPALEEQFATGRVLACISSRPGQ
CEL10009|rps-8       RTKTLVKGAIISVDAAPFRQWYEAHYALPLARKKN--AKLSE--------EDNAILNKKRSHHTMKKYTERQKTAAVDALLIEQFNTGRLLARISSSPGQ
BMA10009|RPS8        RTKTLVKNSIITVDAVPFRQWYEAHYAVPLARKKG--AKLTD--------EEEARINKKRSKKVQAKYTERQKLAEVEPHLIEQFQSGRLLACISSRPGQ
STE10009|RPS8        RTKTLVKNCIVQVDSTPFRQWYEAHYAIPIGRKKT--KQPTE--------EEQEILNKKRSNHCTRKLEARKANAKVAPGMEEQFVTGRLYACVSSRPGQ
MBR10009|RPS8        RTKTLVKNAIIVVDATPFKQWYETHYGLPIGKKKGG-RNQSE--------VDEAILNKPRSNHLKRKLEERKAGAKVDVHLEEQFAAGRLYACVSSRPGQ
NEU10009|Rps8        RTNTLTKSAVVQIDAAPFRQWYEAHYGQPLGRRRQ----QKQ--------GQVVEEVKKSKSVEKKQAERFAAAGKVDPALEKQFEAGRLYAVISSRPGQ
GRA10009|Rps8        RTNTLTKSAVVQVDAAPFRQWYEAHYGQAIGRRRQKAQAAKE--------GKTEEEVKKSNAVEKKQAARMSAGGKVESAIEKQFEAGRLYAVVSSRPGQ
STA10009|Rps8        RTNTLTRSAVVQIDAAPFRQWYEAHYGVSLGRRRQ----VKA--------GEKAEDIKKSNAVAKKQTERVKTSGKVENAVEKQFEAGRLYAVVSSRPGQ
YAR10009|Rps8        RTNTLTKSAIVQIDATPFRQWYESYYGKSLGKKKA----------------GQEEPVIAEAD--QAAVAARQADAKLDPAVEAQFGAGRLYACVSSRPGQ
POM10015|RPS8-1      RTNTLTKSAIVQIDAAPFRVWYETHYGILMGSKGK---------------KATSTPNPKSKHVQRKHSARLGDS-KVDSALETQFAAGRLYAVVSSRPGQ
POM10016|RPS8-2      RTNTLTKSAIVQIDAAPFRVWYETHYGILMGSKGK---------------KATATPTPKSKHVQRKHSARLGDS-KVDSALETQFAAGRLYAVVSSRPGQ
YST10014|RPS8A       RTNTLTKAAIVQIDATPFRQWFEAHYGQTLGKKKN----------------VKEEETVAKSKNAERKWAARAASAKIESSVESQFSAGRLYACISSRPGQ
YST10015|RPS8B       RTNTLTKAAIVQIDATPFRQWFEAHYGQTLGKKKN----------------VKEEETVAKSKNAERKWAARAASAKIESSVESQFSAGRLYACISSRPGQ
CIN10009|Rps8        RTNTLVKGCIIQIDATPFRQWYEAHYAQPVTKK-----GKST--------IPTDAEPKKLSNHAQRKLDERKKDAKIDPLLETQFGAGRLYAAITSRPGQ
NEA10009|Rps8        RTQTLVKGAVVDIDATPFRQWYESHYAQPAFRG-----AKSA--------AAEEAD-KKQSNHVKRILEERKKVAKIDPLLEQQFKAGRLLAVISSRPGQ
MAY10009|Rps8        RTNTLVKGCIVQVDATPFRQAYEKHYGQPVTTKRRAA-GQGA--------AEANADEAKLSNNVTRKLENRRKEGKLDSLVEQQFGAGRLYAAVSSRPGQ
RHI10035|Rps8        RTNTLVKGAVIQIDATPFRQWYESHYALPLGKQKS------G--------EEAAS-AEKKSKSVEKKIAARAATAAIDPLLNDQFNAGRLYAVIASRPGQ
RHI10036|Rps8-2      RTNTLVKGAVIQIDATPFRQWYESHYALPLGKQKS------G--------EEAAS-AEKKSKSVEKKIAARAATAAIDPLLNDQFNAGRLYAVIASRPGQ
RHI10037|Rps8-3      RTNTLVKGAVIQIDATPFRQWYESHYALPLGKQKA------T--------ETAEAEKEKKSKSVEKKIAARAATAAIDPLLNDQFNAGRLYAVIASRPGQ
RHI10038|Rps8-4      RTNTLVKGAVIQIDATPFRQWYESHYAIALGKKKAG---AHA--------EEVEKSAESKSKAVQKKLAARAAAAAVDPLLDDQFNAGRLYAVIASRPGQ
RHI10039|Rps8-5      RTNTLVKGAVIQIDATPFRQWYESHYALPLGKQKS------G--------EEAAS-AEKKSKSVEKKIAARAATAAIDPLLNDQFNAGRLYAVIASRPGQ
ARA10022|RPS8A       RTKTLVKSAIVQVDAAPFKQWYLSHYGVELGRKKKSASSTKKDGEEGEEAAVAAPEEVKKSNHLLRKIASRQEGRSLDSHIEDQFASGRLLACISSRPGQ
ARA10023|RPS8B       RTQTLVKSAIVQVDAAPFKQGYLQHYGVDIGRKKK--------------GEAVTTEEVKKSNHVQRKLEMRQEGRALDSHLEEQFSSGRLLACIASRPGQ
RIC10023|RPS8A       RTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKAPAAKK--DAAEGQEGEAATEEAKKSNHVVRKLEKRQQTRTLDSHIEEQFGSGRLLACISSRPGQ
GMA10045|LOC10080300 RTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKSAAAS---VKKEGEDGEAATEEVKKSNHVVRKLEKRKQNRVLDPHIEEQFGGGRLLACISSRPGQ
GMA10046|LOC10079493 RTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAKKE--TAEEGGDAAAAAEEAKKSNHVQRKLEKRQKDRKLDAHIEEQFGGGRLLACISSRPGQ
GMA10047|LOC10081317 RTQTLVKSAIVQVDAAPFRQWYLQHYGVEIGRKKKVAAKKD--STEEG---EAAAEETKKSNHVQRKLEKRQKDRNLDSHIEEQFGGGRLLACISSRPGQ
GMA10048|LOC10052766 RTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTAAKKE--TAEEG-AAAVAVEEAKKSNHLQRKLEKRQKDRKLDAHIEEQFGGGRLLACISSRPGQ
GMA10049|LOC10052732 RTQTLVKSAIVQVDAAPFKQWYLQHYGVEVGRKKKSAAAS---AKKEGEDGEAATEEVKKSNHVLRKLEKRKQNRVLDPHIEEQFGGGRLLACISSRPGQ
POP10009|RPS8        RTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKAVVKKE--TPE--QEGEATTEETKKSNHVIRKLEKRQQVRKLDPHIEEQFGSGRLLASISSRPGQ
CRE10009|RPS8        RTQTLVKNAIVQVDATPFKQWYQKHYNVELGAKN-QAEIVP------------KPEEIKGSNHVKRKIKERLQKRKLDSHLAEQFSTGRLFACISSRPGQ
VOL10010|RPS8        RTQTLVKNAIVQVDATQFKQWYQKHYNVELGAKKDQPDVAP------------KPEEIQGSNHVKRKIKERLQKRKLDPHLAEQFTTGRLFACIASRPGQ
HEM10008|rps8        RTNTLVKGAIIFIDSSPFKNWAKQNNYIFPKEKKIFKNDEKN--------------------------SPKNLKKEKETNLWEQINSGKVLARICSRPGQ
PTR10009|RPS8        RTKTLVKGAIVLIDAHPFKNWYDSHYGVTIGLKKTGGEDRTQ----------PSVDLTEKSTQVQKKLKSRQANRSLDSVLDHQFASGRLLAKITSRPGQ
TPS10009|Rps8        RTKTLVKGAIVLVDAHPFKSWYESHYGVKIGIKKG----QAA----------AEEEEVKQSSHVQRKLAARQKGRSLEDAIDHQIASGRLYAKITSRPGQ
CYA10009|RPS8        RTNTLVKGSIVHIDATPFRTWYFQHYGIDLGKKAVSSADAT----------DGTTTEAKRSASVLAKLAARQAKRSLEKALEDQFNSGRLLACIASRPGQ
DIC10009|RPS8        RTNTLVKGSIVQIDATPYKQWYETHYGVVVGKKKS--AKKDG----------EAEQVVKKSASLLAKLASRAKGRVLDSAIESQIGEGRFFARITSRPGQ
PLA10009|RPS8        RTKTLVKNCIVVIDSHPFTTWYENTFGTTLGKKKKEKKEEDNKEENKQEVENNEEAAKDETTKTYGVIKKIGKSKNIDPLLLEQFKQGRVLACISSRPGQ
TGO10009|RPS8        RTNTLVKNSIVAIDATPFKAWFRSFYGLDLGKKKAGQEEEGSRKVSKHTLCLQN-------------KHRQQGVPKLDPLLEEQFNTGRLLACISSRPGQ
GIA10009|Rps8        RTNTLVKGCVVQIDSAPFKSALSN--------------------------------------------------DTLDKEILDQIRGDHILARISSRPGQ
HAL10036|VNG1668G    RRNIITKGAIIETDAG--------------------------------------------------------------------------TARVTSRPGQ
MET10009|MJ0673      RRNVITKGAIIETEIG--------------------------------------------------------------------------LAKVTSRPGQ
PYR10039|PH1103      RRNIITKGAIIETEIG--------------------------------------------------------------------------KAKVTSRPGQ
SUL10041|ST0188      RRGIIVKGSIIQTELG--------------------------------------------------------------------------KAKVTSRPGQ


HUM10010|RPS8        CGRADGYVLEGKELEFYLRKIKARKGK-----
DOG10009|Rps8        CGRADGYVLEGKELEFYLRKIKARKGK-----
MUS10009|Rps8        CGRADGYVLEGKELEFYLRKIKARKGK-----
RAT10009|Rps8        CGRADGYVLEGKELEFYLRKIKARKGK-----
CHK10009|Rps8        CGRADGYVLEGKELEFYLRKIKARKGK-----
FUG10009|RPS8        CGRADGYILEGKELEFYLRKIKAKKGK-----
DAN10009|Rps8        CGRADGYVLEGKELEFYLRKIKAKKGK-----
MED10009|Rps8        CGRADGYVLEGKELEFYLRKIKAKKGK-----
CIO10009|RPS8        SGRCDGYILEGKELEFYQRKIKARKGK-----
DRO10011|RpS8        CGRSDGYILEGKELEFYLKKIKSKK-------
MOS10009|Rps8        VGRADGYILEGKELEFYLKKIKNKKSK-----
BEE10009|Rps8        CGRADGYILEGKELEFYMRKIKSKKAK-----
CEL10009|rps-8       VGQANGYILEGKELDFYLRKIRAKKAK-----
BMA10009|RPS8        VGRADGYILEGKELEFYLRKIRAKKAK-----
STE10009|RPS8        SGRCDGYILEGKELEFYIKKLKARKAK-----
MBR10009|RPS8        SGRCDGYILEGKELDFYLRKLRSRR-------
NEU10009|Rps8        SGRCDGYILEGEELAFYQRKLHK---------
GRA10009|Rps8        SGRVDGYILEGEELAFYQRKLHK---------
STA10009|Rps8        SGRCDGYVLEGEELAFYQRGLRK---------
YAR10009|Rps8        SGRVDGYVLEGEELAFYLKKIVSKK-------
POM10015|RPS8-1      SGRCDGYILEGEELHFYLRRMAPKK-------
POM10016|RPS8-2      SGRCDGYILEGEELHFYLRRMAPKK-------
YST10014|RPS8A       SGRCDGYILEGEELAFYLRRLTAKK-------
YST10015|RPS8B       SGRCDGYILEGEELAFYLRRLTAKK-------
CIN10009|Rps8        SGRADGYILEGKELEFYLRKLRTTKQK-----
NEA10009|Rps8        SGRADGYILEGKELEFYHHKLQIRKAKHAA--
MAY10009|Rps8        SGRCDGYILEGKELEFYVRRLKASKGKQ----
RHI10035|Rps8        SGRCDGYILEGKELEFYLRKIKVKKQ------
RHI10036|Rps8-2      SGRCDGYILEGKELEFYLRKIKSKKQH-----
RHI10037|Rps8-3      SGRCDGYILEGKELEFYLRKIKSKKQH-----
RHI10038|Rps8-4      SGRCDGYILEGKELEFYLRKIKSRK-------
RHI10039|Rps8-5      SGRCDGYILEGKELEFYLRKIKSKKQH-----
ARA10022|RPS8A       CGRADGYILEGKELEFYMKKIQKKKGKGAA--
ARA10023|RPS8B       CGRADGYILEGKELEFYMKKLQKKKGKNAGAA
RIC10023|RPS8A       CGRADGYILEGKELEFYMKKLQRKKGKGAAA-
GMA10045|LOC10080300 CGRADGYILEGKELEFYMKKLQKKKGKGAA--
GMA10046|LOC10079493 CGRADGYILEGKELEFYMKKLQKKKGKGAA--
GMA10047|LOC10081317 CGRADGYILEGKELEFYMKKLQRKKGKGAA--
GMA10048|LOC10052766 CGRADGYILEGKELEFYMKKLQKKKGKGAA--
GMA10049|LOC10052732 CGRADGYILEGKELEFYMKKLQKKKGKGAA--
POP10009|RPS8        CGRADGYILEGKELEFYMKKIQRKKGKGAGAA
CRE10009|RPS8        CGRCDGYILEGKELEFYVKKMQKKKSKAA---
VOL10010|RPS8        CGRADGYILEGKELEFYLKKMQKKKSKAA---
HEM10008|rps8        TGRSDGYILEGSELEFYIKKIHKKKL------
PTR10009|RPS8        TGRCDGYILEGAELAFYQKQMAKK--------
TPS10009|Rps8        SGRCDGQILEGAELSFYLKQLKK---------
CYA10009|RPS8        CGRADGYILEGKELEFYLKKLERRKKTK----
DIC10009|RPS8        VGKCDGYILEAKELEFYQRRLQKKKSAK----
PLA10009|RPS8        CGKADGYIIEGDELLFYKRKMDKKKRN-----
TGO10009|RPS8        SGRADGYILEGEELMFYKRKMDKKKHK-----
GIA10009|Rps8        VGTADGYILEGPELLFYQKKLAPK--------
HAL10036|VNG1668G    DGQVNATRVDE---------------------
MET10009|MJ0673      DGTVNAILIKE---------------------
PYR10039|PH1103      DGVVNAILLEE---------------------
SUL10041|ST0188      DGTINAILIKE---------------------