CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10006|VNG1707G    --------------------------------MVGSVLEVFYDRGYIDGFEFVDNGKAGRFEVELKGAINECG-------PVNPRYSVG---ADGFEQWE
MET10010|MJ0470      MSLMDPLANALNHISNCERVGKKVVYIKPASKLIGRVLKVMQDNGYIGEFEFIEDGRAGIFKVELIGKINKCG-------AIKPRFPVK---KFGYEKFE
PYR10006|PH1764      MTLLDPLANALSHITNSERVGKREIYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQLLGRINKAG-------AIKPRFPVK---ATEYEKWE
THE10008|TTHA1678    -MLTDPIADMLTRIRNATRVY-KESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVK
SYN10009|sll1809     MASTDTISDMLTRIRNACAVR-HSTTQVPTTKMTLSIAKVLKSEGFIEDYSETGEGINKMLVLTLKYKGKTR------QPLINTLQRVSKPGLRVYSPSK
BAC10008|Bsu0130     MVMTDPIADMLTRIRNANMVR-HEKLEIPASKLKREIPEILKREGFIRDVEFVEDSKQGIIRVSLKYGQNN-------ERVITGLKRISKPGLRVYAKSN
ECO10008|rpsH        MSMQDPIADMLTRIRNGQAAN-KAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQG---------KAVVESIQRVSRPGLRIYKRKD
SUL10006|ST0419      MVNLNPLANALTTIYNNEMRRNKQAIIMPASKLIINVLRAMQKEGYIGEFEFIDDGRSGKIVVQLLGRINKCG-------PIAPRYPLKYKDLLTLPDYV


HAL10006|VNG1707G    KRYLPARDYGSLVVTTSHGIMSHYEAREAGIGGQVIAYVY
MET10010|MJ0470      KRYLPARDFGILIVSTTQGVMSHEEAKKRGLGGRLLAYVY
PYR10006|PH1764      KRFLPAFEFGILIVSTSQGVMSHKEARDRGIGGRLIAYVY
THE10008|TTHA1678    EIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
SYN10009|sll1809     KIPRVLGGIGIAIVSTSHGIMTDREARRQGIGGEILCYIW
BAC10008|Bsu0130     EVPRVLNGLGIAIISTSQGVLTDKEARAKQAGGEVLAYVW
ECO10008|rpsH        ELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
SUL10006|ST0419      RRYLPSKEIGVLIISTNKGVMTHKDAIRERIGGVALGYVY