CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10011|RPS9        -----MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLD
DOG10010|Rps9        -----MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLD
MUS10010|Rps9        -----MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLD
RAT10010|Rps9        -----MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLD
FUG10010|RPS9        -----MPVARSWVCSKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDEGKMKLD
DAN10010|Rps9        -----MPVAKTWVCSKTYVTPRRPFEKSRLDQELRLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDEGKMKLD
MED10010|Rps9        -----MPVARTWVCSKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDSRRLFEGNALLRRLVRIGVLDEGKMKLD
CIO10010|RPS9        -----MPHARRLVYRKTYVTPRRPFEKARLDQELKLIGEYGLRNKREVWRVKYTLAKIRKAARDLLTLDEKNTRRLFEGNALLRRLVRIGVLDETKMKLD
DRO10012|RpS9        ----MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLD
MOS10010|Rps9        ----MVNHRIPSVFSKTYVTPRRPFEKPRLDAELKIIGQYGLRNKREVWRVKYTLAKIRKAARELLTLEEKDEKRLFQGNALLRRLVRIGVLDESRMKLD
BEE10010|Rps9        ----MVNGRIPSVFSKTYVTPRRPYEKARLDQELRIIGEYGLRNKREVWRVKYTLANIRKAARELLTLEEKDPKRLFEGNALLRRLVRIGVLDESRMKLD
CEL10010|rps-9       ------MARLKTVQSKVTKSPRRPFEKERLDQELKLIGTFGLKNKREVWRVKYTLAKVRKAARELLTLEDKDPKRLFEGNALLRRLVKIGVLDETKMKLD
BMA10010|RPS9        ------MPRVKNVMSKVYKSPRRPFEKERLDQELKLIGEFGLRNKREVWRVKYTLAKIRKAARTLLTLEEKDPRRLFEGNALLRRLVRIGVLSEDRMKLD
STE10010|RPS9        --------MPQVVCSKTYTTPRRPFEKERLNQELKIIGEYGLRNKREVWRVKLTLAKIRKAARELLTLEEKDPRRLFEGNALLRRLVRIGVLDESRKKLD
MBR10010|RPS9        MGRVTGVSVAPKVFSKTAVAPRRPFEKARLDQELKLVGEFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPRRLFEGNAILRRLIRLGVIDEDRMKLD
NEU10010|Rps9        --------MAPRSYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARQLLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMKLD
GRI10010|Rps9        --------MVRPSYSKTAKVPRRPFEAARLDSELKLVGEFGLKNKREVWRVQLTLSKIRRAARQLLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMKLD
GRA10010|Rps9        --------MPPRAHSKTSRVPRRPFESARLDSELKLVGEYGLRNKREVWRVGLTLSKIRRAARQLLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMKLD
STA10010|Rps9        --------MVARSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMRLD
YAR10010|Rps9        ------MPRAPRTYSKTASTPNRPYESARLDAELKLDGEFGLKNKREIYRIGLQLSKIRRAARELLTRDEKDPKRLFEGNALIRRLVRLGVLPEDRMKLD
POM10017|RPS9-1      ------MPSAPRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWRVALTLSKIRRAARELLTLDEKDPKRLFEGNAIIRRLVRLGILDETRMKLD
POM10018|RPS9-2      ------MPSAPRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWRVALTLSKIRRAARELLTLDEKDPKRLFEGNAIIRRLVRLGILDESRMKLD
YST10016|RPS9A       ------MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLD
YST10017|RPS9B       ------MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLD
CIN10010|Rps9        ------MPRAPRNHSKTYKVPRRPYESARLDAELKLAGEYGLRNKREIWRIALTLSKIRRAARELLKLDAKDPKRLFEGNALIRRLVRIGVLDESRMRLD
NEA10010|Rps9        ------MTCAPRKQSKTYKVPKRPYEAARLDAELKLAGEYGLRNKREIWRIQLTLSKIRRAARELLKLDDKDPKRLFEGNALIRRLVRIGVLDDTRMRLD
MAY10010|Rps9        ------MPRAPRKQSKTAKVPRRPFESARLDSELKLAGEYGLRNKREIWRIALTLSKIRRAARELLKLDEKDPKRLFEGNAIIRRLVRIGVLDETRMRLD
RHI10040|Rps9        ------MTGTTRNYHKTSTVPKRPFESARLDQELKLIGEFGLKNKREIWRVGFTLSKIRRAARELLKLDEKDPRRLFEGNALIRRLVRIGVLDETRMKLD
RHI10041|Rps9-2      ------MTGTTRNYHKTSTVPKRPFESARLDQELKLIGEFGLKNKREIWRVGFTLSKIRRAARELLKLDEKDPRRLFEGNALIRRLVRIGVLDETRMKLD
RHI10042|Rps9-3      ------MTGTTRNYHKTSTVPKRPFESARLDQELKLIGEFGLKNKREIWRVGFTLSKIRRAARELLKLDEKDPRRLFEGNALIRRLVRIGVLDETRMKLD
ARA10024|RPS9B       ----MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARDLLTLDEKSPRRIFEGEALLRRMNRYGLLDESQNKLD
ARA10025|RPS9C       ----MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARELLTLDEKNPRRIFEGEALLRRMNRYGLLDETQNKLD
RIC10025|RPS9C       ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLD
RIC10026|RPS9C       ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLD
RIC10027|RPS9C       ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLD
GMA10050|LOC10080764 ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARNLLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLD
GMA10051|LOC10079009 ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARNLLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLD
GMA10052|LOC10081056 ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARNLLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLD
GMA10053|LOC10080764 ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARNLLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLD
POP10010|RPS9        ----MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARMLLTLDEKNQRRIFEGEALLRRMNRYGLLEESQNKLD
CRE10010|RPS9        ----MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARVLLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLD
VOL10011|RPS9        ----MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARVLLTLEEKDPKRIFEGNALMRRMNRYGLLSESQDKLD
HEM10009|rps9        ------MGKNYRNYSKTYRTPRRPFEKERLESELKLVGEYGLRNKKEVWRVQLSLSKIRASARILLTLPEKDPRRLIQGKSLIKRLRKYGILEENQETLD
PTR10010|RPS9        ----MPTNAMHRNYSKTSKTPRRPFEKERLDAELKLVGEYGLRCKREIWRVQFALAKLRKAARTLLTLDPSDPKRIFEGAALLRRMNRYGLLADDELELD
TPS10010|Rps9        ----MPTNAQHRNYRKTYKTPRRPYEKERLDAELKLVGEYGLRCKREIWRCQYALAKLRKAARTLLTLDPKDPKRIFEGTALLRRMSRYGLLAEDELELD
CYA10010|RPS9        ------MGKSYRNFSKVYKIPRRPFEKERLDAELKLCGEYGLRNKREVWRVQYALSKIRAAARELLTKDEKDERRIVEGAALLRRLTRYGLLDQTQQDLN
DIC10010|RPS9        ---------MSSNYSKTSHTPRRPFEKERIDAELKVVGEFGLKNKNEVWRVQYALAKIRKAARELLVLDEKDPKRIFEGSALLRRLHKLGVMEESKNKLD
PLA10011|RPS9        ------MPKSYRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLTLDEKSSKRIFQGEALLRRMVRQGLLGENEEKLD
TGO10010|RPS9        ------MTKSYRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEEKDPRRVFQGTALLRRMVRLGLLGESEQKLD
GIA10010|Rps9        ----MPRISRHRNSSKTYSTPKKPFTKPRLDAELKLCGEYGLKCKREIYRARYMLAKIRRTARNLLTLDENDIKRRFEGAALLRRLHMLGILDEEKDQLD


HUM10011|RPS9        YILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKGQGGAGAGDDEEED
DOG10010|Rps9        YILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKGQGGAGAGDDEEED
MUS10010|Rps9        YILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKGQGGAGAGDDEEED
RAT10010|Rps9        YILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKGQGGAGAGDDEEED
FUG10010|RPS9        YILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKGQGGSGGADDEEED
DAN10010|Rps9        YILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKAQGGGGGGDDEEED
MED10010|Rps9        YILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKGQGGAGGADDEEED
CIO10010|RPS9        YVLGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYG-GGRPGRVKRKNAKKGSNTNEEEDED---
DRO10012|RpS9        YVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFG-GGRPGRVKRKNLKKNQGGGGGAAEEEED
MOS10010|Rps9        YVLGLRIEDFLERRLQTQVFKLGLAKSYHHARVLIRQRHIRVRKQVVNVPSFIVRLDSQKHIDFSLKSPFG-GGRPGRVKRKNLKKGQGGGGAAEEEEED
BEE10010|Rps9        YVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFG-GGRPGRVKRKNLRKGSGGAAPEEEED--
CEL10010|rps-9       YVLGLKVEDFLERRLQTQVFKLGLAKSIHHARILIKQHHIRVRRQVVDVPSFIVRLDSQKHIDFSLQSPYG-GGRPGRVKRRTLRKGDGAGGDDEE----
BMA10010|RPS9        YVLGLRVEDFLERRLQTQVFKLGLAKSIHHARVLIRQKHIRVRRQIVNVPSFIVRLDSQKHIDFSLKSPFG-GGRAGRVKRRNAKKGVSGEDEVSDGEE-
STE10010|RPS9        YVLGLRIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQLVNVPSFVVRLDSQKHIDFSLNSPYG-GGRPGRVKRKNMKKGQGGSGGEDEDED-
MBR10010|RPS9        YVLGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNVPSYMVRLDSQKHIDFALKSPFG-GGRPGRVKRRNLRNKGGDDAADDEE---
NEU10010|Rps9        YVLALKAEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPFG-GGRPGRVRRKKAKAAEGGEAAEEEDEE-
GRI10010|Rps9        YVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPFG-GGRPGRVRRKKAKSAEGGEDAGDDEDEE
GRA10010|Rps9        YVLALKIEDFLERRLQTCVWKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPFG-GGRPGRVRRKKAKAAEGGEGGEDEEDEE
STA10010|Rps9        YVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPFG-GGRPGRVRRKKAKAAEKGGDDDAGEEDE
YAR10010|Rps9        YVLALSPEDFLERRLQTQVFKLGLAKSIHHARVLISQRHIRVGKQIVNVPSFMVRLESQKHIDFALNSPYG-GGRPGRVKRKNAQKGASEDAEEEEDEE-
POM10017|RPS9-1      YVLALRIEDFLERRLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKHIDFALSSPYG-GGRPGRCKRKRLRSQ-EGGEGEEAEEE-
POM10018|RPS9-2      YVLALRIEDFLERRLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDAQKHIDFALSSPYG-GGRPGRCKRKRLRSQQEGGEGEEAEEE-
YST10016|RPS9A       YVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFG-GARPGRVARRNAARKAEASGEAADEADE
YST10017|RPS9B       YVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFG-GARPGRVARRNAARKAEASGEAAEEAED
CIN10010|Rps9        YVLALKIEDFLERRLQTQVFKIGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYG-GGRPGRVKRKRAAAAAAKEDGDEEDEE-
NEA10010|Rps9        YVLALKTEDFLERRLQTQVFKLGLAKSVHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDYALTSPYG-GGRPGRVKRKRAKAAAGGGDDAEEEDEE
MAY10010|Rps9        YVLALKIEDFLERRLQTQVFKSGLAKSIHHARVLIVQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPYG-GARAGRVKRKRARAAAEAAGGDDAEEDE
RHI10040|Rps9        YVLALKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPYG-GGRAGRVKRKRAAAGSGEAADEEDEE--
RHI10041|Rps9-2      YVLALKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPYG-GGRAGRVKRKRAAAGSGEAADEEDEE--
RHI10042|Rps9-3      YVLALKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPYG-GGRAGRVKRKRAAAGSGEAADEEDEE--
ARA10024|RPS9B       YVLALTVENFLERRLQTIVFKSGMAKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPFG-GGRPGRVKRRNEKSASKKASGGGDADGD
ARA10025|RPS9C       YVLALTVENFLERRLQTIVFKSGMAKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPFG-GGRPGRVKRRNERAGAKKASGGDGDEDD
RIC10025|RPS9C       YVLALTVENFLARRLQTLVFKAGMAKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFG-GGPPGRVKRKNQKKASGGGGDGEEEDEE
RIC10026|RPS9C       YVLALTVENFLARRLQTLVFKAGMAKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFG-GGPPGRVKRKNQKKASGGGGDGEEEDEE
RIC10027|RPS9C       YVLALTVENFLARRLQTLVFKAGMAKSIHHARVLIRQRHIRQ---IVNIPSFMVRVESEKHIDFSLTSPFG-GGPPGRVKRKNQKKASGGGGDGEEEDEE
GMA10050|LOC10080764 YVLALTVENFLERRLQTLVFKSGMAKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLG-GGRPGRVKRKNQRAAAKKAAGGDGDEED
GMA10051|LOC10079009 YVLALTVENFLERRLQTLVFKSGMAKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLG-GGRPGRVKRRNQRAAAKKAAGGDGDEED
GMA10052|LOC10081056 YVLALTVENFLERRLQTLVFKSGMAKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPLG-GGRPGRVKRRNQRAAAKKAAGGDGDEED
GMA10053|LOC10080764 YVLALTVENFLERRLQTLVFKSGMAKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPLG-GGRPGRVKRKNQRAAAKKAAGGDGDEED
POP10010|RPS9        YVLALTVENFLERRLQTLVFKAGMAKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFG-GGRPGRVKRKNQKAASKKAAGGDGDEED
CRE10010|RPS9        YVLALTPQDFLERRLQTLVFKQGLAKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFG-GGRPGRVKRKNAKKGGDGGEDDE-----
VOL10011|RPS9        YVLALTPQDFLERRLQTLVFKQGLAKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPFG-GGRPGRVKRKNAKKGGDGGDDDE-----
HEM10009|rps9        HILSLKIQDFLERRLQTIVFKKKLAESIHHSRVLIKQRHISVDKRLVDVPSFLVRLKSQDKIEYFSKSPLG-GGLPGRNLRKTLKKEN------------
PTR10010|RPS9        TVLQLTTQKLLERRLQTKVYKQGLAKSIHHARVLIRQRHIRVGSQLVNVPSFNVRTASEKHIDFSTNSPYG-QGAPGRVARKRAASRAAGGGDEEE----
TPS10010|Rps9        FVLQLTTQKLLERRLQTKVFKQGLAKSIHHARVLIRQRHISVGGQLVNVPSFNVRTSSEKHIDISADSPYG-QGAPGRVAKKRAAAKAAAGDDDE-----
CYA10010|RPS9        YVLSLKVQDFLERRLQTQVFKLGLAKSIHHARVLILQRHIRVGKQLVTVPSFMVRVDSQKHIDFAPTSPFG-GGRPGRVKRRRLRRESSGDAGDAADDDE
DIC10010|RPS9        YILNLKVQDFMERRLQTLVFKNGLAKSIHHARVLIKGRHIRVGKQLVNVPSFLVRVESQKHLGLASTSPLA-GGRPGRRARKMAKNNSSKGEEEN-----
PLA10011|RPS9        YVLGLTLPKLLERRLQTKVFKLGLAKSVHHARVLIRQRHIRVGKQMVDIPSFLVRVDSEKHIDFATTSPFG-GARPGRVKRKSLKKQKEKTEAEAE----
TGO10010|RPS9        YVLGLTVAKFLERRLQTKVFKLGLAKSIHHARVLIRQRHIRVGKHIVDIPSFMVRVDSEKHVDYAITSPFG-GGRPGRVKRRSLKGGNAEGGDDE-----
GIA10010|Rps9        YVLGLRIEDIFKRRLQSVIVESKLAKSVHHARNMIKARHISVGGQIVNIPSYMVRISNTSRVAIADTSSLAPNGKPGRTKRAAARRQSSGDNE-------


HUM10011|RPS9        ----
DOG10010|Rps9        ----
MUS10010|Rps9        ----
RAT10010|Rps9        ----
FUG10010|RPS9        ----
DAN10010|Rps9        ----
MED10010|Rps9        ----
CIO10010|RPS9        ----
DRO10012|RpS9        ----
MOS10010|Rps9        ----
BEE10010|Rps9        ----
CEL10010|rps-9       ----
BMA10010|RPS9        ----
STE10010|RPS9        ----
MBR10010|RPS9        ----
NEU10010|Rps9        ----
GRI10010|Rps9        ----
GRA10010|Rps9        ----
STA10010|Rps9        E---
YAR10010|Rps9        ----
POM10017|RPS9-1      ----
POM10018|RPS9-2      ----
YST10016|RPS9A       ADEE
YST10017|RPS9B       EE--
CIN10010|Rps9        ----
NEA10010|Rps9        ----
MAY10010|Rps9        E---
RHI10040|Rps9        ----
RHI10041|Rps9-2      ----
RHI10042|Rps9-3      ----
ARA10024|RPS9B       DEE-
ARA10025|RPS9C       EE--
RIC10025|RPS9C       ----
RIC10026|RPS9C       ----
RIC10027|RPS9C       ----
GMA10050|LOC10080764 ED--
GMA10051|LOC10079009 ED--
GMA10052|LOC10081056 ED--
GMA10053|LOC10080764 ED--
POP10010|RPS9        EE--
CRE10010|RPS9        ----
VOL10011|RPS9        ----
HEM10009|rps9        ----
PTR10010|RPS9        ----
TPS10010|Rps9        ----
CYA10010|RPS9        ----
DIC10010|RPS9        ----
PLA10011|RPS9        ----
TGO10010|RPS9        ----
GIA10010|Rps9        ----