CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10007|VNG1139Gm   ---------MVTNTSGKKKTAVARATVSDGEGRVRINSQPVELVEPEMARLKMLEPFRISGSDLRGDVDIDIDVAGGGFAGQADAVRTAIARGLVEHYGD
MET10011|MJ0195      -------MGKIVITVGKRKRAIARAVAREGKGRIRINKIPIELIEPKYKRMKLMEPILLAGEEVISQMDIDVTVKGGGVMGQMDAARTAIGKAIVEFTGS
PYR10007|PH1633      --------MRIIQTTGKRKTAIARAVIREGRGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSVDIDVKVQGGGFMGQAEAARIAIARALVEWTGD
THE10009|TTHA1464    --------MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEP-LRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPD
SYN10010|sll1822     MQANDSSNKVVYWGTGRRKAAIARVRLVPGQGEVIVNGKPGEIYFNRIANYIQSLKAPLETLGLEGEYNILVNAHGGGLTGQADAVKLGVARALCQLSPE
BAC10009|Bsu0150     ------LAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIP-SAALIEDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPE
ECO10009|rpsI        ------MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFG-RETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDES
SUL10007|ST2064      ----MSQQSQVIITYARRKMARARCYITPGKGRVFVNDIPLEIIPMEVVRMKIMEPLLLAGEKISSSIDAKIYVEGGGVMGQADAARMALARALVKFTGS


HAL10007|VNG1139Gm   AELRDAFREFDRSLLVNDVRQRESKK--WGGPGARARYQKSYR
MET10011|MJ0195      KELRDKFLAYDRTLLVSDARRTEPHKPSRSTKGPRAKRQKSYR
PYR10007|PH1633      MNLKEKFIKYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR
THE10009|TTHA1464    ----YRAKLKPLGFLTRDARVVERKK--YGKHKARRAPQYSKR
SYN10010|sll1822     ----NRQPLKAEGYLTRDPRAKERKK--YGLHKARKAPQYSKR
BAC10009|Bsu0150     ----YRTTLKRAGLLTRDARMKERKK--YGLKGARRAPQFSKR
ECO10009|rpsI        ----LRSELRKAGFVTRDARQVERKK--VGLRKARRRPQFSKR
SUL10007|ST2064      KELEEIYKVYDRTMLAGDPRQTESEK--WMRYSARRWRQKAYR